You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CTAG1A
Cancer/testis antigen 1

Protein Summary
Description
The protein encoded by this gene is an antigen that is overexpressed in many cancers but that is also expressed in normal testis. This gene is found in a duplicated region of the X-chromosome and therefore has a neighboring gene of identical sequence. [provided by RefSeq, Jan 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000328435
  • ENSP00000332602
  • ENSG00000184033
  • ENST00000359887
  • ENSP00000352953
  • ENST00000599837
  • ENSP00000469441
  • ENSG00000268651

Symbol
  • CTAG
  • CTAG1
  • ESO1
  • LAGE2
  • LAGE2A
  • CTAG
  • ESO1
  • CT6.1
  • CTAG1
  • LAGE-2
  • LAGE2B
  • NY-ESO-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease
0.38
gene perturbation
0.36
biological term
0.33
interacting protein
0.31
small molecule perturbation
0.24


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 610.93   (req: < 5)
Gene RIFs: 83   (req: <= 3)
Antibodies: 681   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 610.93   (req: >= 5)
Gene RIFs: 83   (req: > 3)
Antibodies: 681   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (14)
1 – 5 of 14
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
LIFEdb
Protein-Protein Interactions (135)
1 – 10 of 135
UBA52
Tbio
Novelty: 0.01006012
p_int: 0.9999996
p_ni: 4e-7
Data Source: BioPlex
GMIP
Tbio
Novelty: 0.0756252
p_int: 0.999994965
p_ni: 0.000005035
Data Source: BioPlex
FLCN
Tbio
Novelty: 0.00262361
p_int: 0.99859578
p_ni: 0.000995135
p_wrong: 0.000409086
Data Source: BioPlex
DDX19B
Tbio
Family: Enzyme
Novelty: 0.05099873
p_int: 0.928225642
p_ni: 0.071774358
Data Source: BioPlex
DPYSL4
Tbio
Family: Enzyme
Novelty: 0.05644394
p_int: 0.913258427
p_ni: 0.086696746
p_wrong: 0.000044827
Data Source: BioPlex
SEC23IP
Tbio
Novelty: 0.13247818
p_int: 0.880944008
p_ni: 0.119053661
p_wrong: 0.000002331
Data Source: BioPlex
PASK
Tbio
Family: Kinase
Novelty: 0.08196721
p_int: 0.875549104
p_ni: 0.124450896
Data Source: BioPlex
MAGEA3
Tbio
Novelty: 0.0035666
Score: 0.873
Data Source: STRINGDB
MAGEA1
Tbio
Novelty: 0.00581327
Score: 0.865
Data Source: STRINGDB
MAGEA4
Tbio
Novelty: 0.00987373
Score: 0.854
Data Source: STRINGDB
Publication Statistics
PubMed Score  610.93

PubMed score by year
PubTator Score  50.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS
1-70
GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA
70-140
DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
140-180
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR