You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SPRR4
Small proline-rich protein 4

Protein Summary
Description
Cross-linked envelope protein of keratinocytes. Involved in UV-induced cornification.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000328051
  • ENSP00000332163
  • ENSG00000184148
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.43
tissue
0.43
tissue sample
0.39
interacting protein
0.38
transcription factor
0.34


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.28   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 12   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.28   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 12   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (39)
1 – 10 of 39
FLG2
Tbio
Novelty: 0.00671156
Score: 0.77
Data Source: STRINGDB
TCHHL1
Tbio
Novelty: 0.06996845
Score: 0.739
Data Source: STRINGDB
KPRP
Tdark
Novelty: 0.21791768
Score: 0.737
Data Source: STRINGDB
SPRR3
Tbio
Novelty: 0.02051465
Score: 0.729
Data Source: STRINGDB
S100A2
Tbio
Novelty: 0.01191452
Score: 0.721
Data Source: STRINGDB
HRNR
Tbio
Novelty: 0.04099163
Score: 0.704
Data Source: STRINGDB
S100A7L2
Tdark
Novelty: 1.2
Score: 0.693
Data Source: STRINGDB
S100A3
Tbio
Novelty: 0.0418135
Score: 0.692
Data Source: STRINGDB
LCE6A
Tdark
Novelty: 13
Score: 0.666
Data Source: STRINGDB
LELP1
Tbio
Novelty: 0.96774194
Score: 0.664
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.28

PubMed score by year
PubTator Score  2.2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSA
1-70
QQASKSKQK
70-79
MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSAQQASKSKQK