You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IKZF1
DNA-binding protein Ikaros

Protein Summary
Description
Transcription regulator of hematopoietic cell differentiation (PubMed:17934067). Binds gamma-satellite DNA (PubMed:17135265, PubMed:19141594). Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs) (By similarity). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (PubMed:17135265, PubMed:17934067). This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding protei ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000331340
  • ENSP00000331614
  • ENSG00000185811
  • ENST00000343574
  • ENSP00000342750
  • ENST00000349824
  • ENSP00000342485
  • ENST00000357364
  • ENSP00000349928
  • ENST00000359197
  • ENSP00000352123
  • ENST00000438033
  • ENSP00000396554
  • ENST00000439701
  • ENSP00000413025
  • ENST00000644005
  • ENSP00000496453

Symbol
  • IK1
  • IKAROS
  • LYF1
  • ZNFN1A1
  • IK1
  • LYF1
  • LyF-1
  • CVID13
  • IKAROS
  • PPP1R92
  • PRO0758
  • ZNFN1A1
  • Hs.54452
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.97
PubMedID
0.77
hub protein
0.71
kinase perturbation
0.71
small molecule perturbation
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 530.21   (req: < 5)
Gene RIFs: 195   (req: <= 3)
Antibodies: 511   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 530.21   (req: >= 5)
Gene RIFs: 195   (req: > 3)
Antibodies: 511   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
NOTCH3 Intracellular Domain Regulates Transcription (R-HSA-9013508)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
NOTCH3 Intracellular Domain Regulates Transcription
Reactome
Signal Transduction
Reactome
Signaling by NOTCH
Reactome
Signaling by NOTCH3
Name
Explore in Pharos
Explore in Source
NOTCH3 Intracellular Domain Regulates Transcription
Signal Transduction
Signaling by NOTCH
Signaling by NOTCH3
Gene Ontology Terms (19)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (307)
1 – 10 of 307
IKZF3
Tbio
Family: TF
Novelty: 0.01346873
p_int: 0.999999936
p_ni: 1.4e-8
p_wrong: 5e-8
Score: 0.812
Data Source: BioPlex,STRINGDB
MIB2
Tbio
Family: Enzyme
Novelty: 0.0194052
p_int: 0.999999601
p_ni: 3.95e-7
p_wrong: 5e-9
Score: 0.449
Data Source: BioPlex,STRINGDB
IKZF2
Tbio
Family: TF
Novelty: 0.0472427
p_int: 0.99999944
p_ni: 3e-9
p_wrong: 5.57e-7
Score: 0.721
Data Source: BioPlex,STRINGDB
KLHDC10
Tdark
Novelty: 0.60606061
p_int: 0.999993026
p_ni: 0.000006973
p_wrong: 1e-9
Score: 0.207
Data Source: BioPlex,STRINGDB
IKZF4
Tbio
Family: TF
Novelty: 0.23024021
p_int: 0.999990065
p_ni: 2e-8
p_wrong: 0.000009915
Score: 0.827
Data Source: BioPlex,STRINGDB
POC1A
Tbio
Novelty: 0.04826931
p_int: 0.999755722
p_ni: 0.000244278
Data Source: BioPlex
FOXK2
Tbio
Family: TF
Novelty: 0.01735878
p_int: 0.999747681
p_ni: 0.000252319
Score: 0.237
Data Source: BioPlex,STRINGDB
CHD3
Tbio
Family: Epigenetic
Novelty: 0.01006124
p_int: 0.999639604
p_ni: 0.000360396
Score: 0.662
Data Source: BioPlex,STRINGDB
IKZF5
Tbio
Family: TF
Novelty: 1
p_int: 0.998491212
p_ni: 0.000007279
p_wrong: 0.001501508
Score: 0.448
Data Source: BioPlex,STRINGDB
CHD4
Tbio
Family: Epigenetic
Novelty: 0.0054352
p_int: 0.997885921
p_ni: 0.002114079
Score: 0.736
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  530.21

PubMed score by year
PubTator Score  519.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRA
1-70
CEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHT
70-140
GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSY
140-210
KQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQ
210-280
KFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL
280-350
HKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAP
350-420
HARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPF
420-490
ECNMCGYHSQDRYEFSSHITRGEHRFHMS
490-519
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS