You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CSF1
Macrophage colony-stimulating factor 1

Protein Classes
Protein Summary
Description
Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of mem ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000329608
  • ENSP00000327513
  • ENSG00000184371
  • ENST00000369801
  • ENSP00000358816
  • ENST00000369802
  • ENSP00000358817
  • ENST00000420111
  • ENSP00000407317

Symbol
  • MCSF
  • CSF-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.95
biological term
0.93
PubMedID
0.93
transcription factor perturbation
0.91
disease perturbation
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1439.76   (req: < 5)
Gene RIFs: 163   (req: <= 3)
Antibodies: 753   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1439.76   (req: >= 5)
Gene RIFs: 163   (req: > 3)
Antibodies: 753   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 43
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-10 signaling
Reactome
Metabolism of proteins
Reactome
Other interleukin signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-10 signaling
Metabolism of proteins
Other interleukin signaling
Gene Ontology Terms (51)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (394)
1 – 10 of 394
AMIGO1
Tbio
Novelty: 0.01866694
p_int: 0.893091611
p_ni: 0.106908381
p_wrong: 8e-9
Data Source: BioPlex
CSF1R
Tclin
Family: Kinase
Novelty: 0.00058475
Score: 0.999
Data Source: Reactome,STRINGDB
IL10
Tbio
Novelty: 0.00007359
Score: 0.982
Data Source: STRINGDB
IL6
Tclin
Novelty: 0.00002829
Score: 0.976
Data Source: STRINGDB
IL34
Tbio
Novelty: 0.01169553
Score: 0.974
Data Source: Reactome,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.955
Data Source: STRINGDB
ALB
Tchem
Novelty: 0.0000092
Score: 0.952
Data Source: STRINGDB
SPP1
Tbio
Novelty: 0.00020502
Score: 0.95
Data Source: STRINGDB
CBL
Tbio
Family: Enzyme
Novelty: 0.00118988
Score: 0.948
Data Source: STRINGDB
FN1
Tchem
Novelty: 0.0000437
Score: 0.948
Data Source: STRINGDB
Publication Statistics
PubMed Score  1439.76

PubMed score by year
PubTator Score  1439.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV
1-70
DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE
70-140
TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP
140-210
LAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQP
210-280
RPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL
280-350
PASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
350-420
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFS
420-490
PQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV
490-554
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLSAQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV