You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ABHD1
Protein ABHD1

Protein Summary
Description
This gene is a member of the AB hydrolase superfamily and encodes a protein with an alpha/beta hydrolase fold. This domain is common to a number of hydrolytic enzymes of widely differing phylogenetic origins and catalytic functions. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316470
  • ENSP00000326491
  • ENSG00000143994
  • ENST00000448950
  • ENSP00000410756
  • ENST00000621324
  • ENSP00000481238

Symbol
  • LABH1
  • LABH1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.8
tissue sample
0.66
cell line
0.47
tissue
0.43
cell type or tissue
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.64   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 125   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.64   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 125   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (44)
1 – 10 of 44
PREB
Tbio
Family: TF
Novelty: 0.00430442
Score: 0.71
Data Source: STRINGDB
OSBPL1A
Tbio
Novelty: 0.17271249
Score: 0.661
Data Source: STRINGDB
ENDOD1
Tdark
Family: Enzyme
Novelty: 0.23953959
Score: 0.658
Data Source: STRINGDB
FGF19
Tbio
Novelty: 0.0025092
Score: 0.649
Data Source: STRINGDB
SNTG1
Tbio
Novelty: 0.03490951
Score: 0.581
Data Source: STRINGDB
CABLES2
Tdark
Novelty: 1.28395062
Score: 0.576
Data Source: STRINGDB
CABLES1
Tbio
Novelty: 0.01097728
Score: 0.576
Data Source: STRINGDB
TEX38
Tdark
Score: 0.53
Data Source: STRINGDB
FAM166A
Tdark
Score: 0.514
Data Source: STRINGDB
KIRREL1
Tbio
Novelty: 0.03852239
Score: 0.508
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.64

PubMed score by year
PubTator Score  0.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAFLEPHCSITTETFYPTLWCF
1-70
EGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQDTYV
70-140
LHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVGISFGGILVL
140-210
NHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIEKVVDIDFVLQ
210-280
ARTIRQFDERYTSVAFGYQDCVTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVAL
280-350
LITARGGHIGFLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSEDRNS
350-405
MLSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAFLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQDTYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVGISFGGILVLNHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIEKVVDIDFVLQARTIRQFDERYTSVAFGYQDCVTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVALLITARGGHIGFLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSEDRNS