You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CLEC1A
C-type lectin domain family 1 member A

Protein Summary
Description
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded protein may play a role in regulating dendritic cell function. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000315330
  • ENSP00000326407
  • ENSG00000150048

Symbol
  • CLEC1
  • CLEC1
  • CLEC-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.62
cell line
0.61
tissue sample
0.57
microRNA
0.45
protein domain
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.91   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 198   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.91   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 198   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (13)
1 – 10 of 13
CCPG1
Tbio
Novelty: 0.12386545
p_int: 0.822120185
p_ni: 0.177879815
Score: 0.313
Data Source: BioPlex,STRINGDB
IL10
Tbio
Novelty: 0.00007359
Score: 0.84
Data Source: STRINGDB
REG1B
Tbio
Novelty: 0.02918085
Score: 0.643
Data Source: STRINGDB
KLRC4
Tbio
Novelty: 0.25869807
Score: 0.547
Data Source: STRINGDB
CLEC2D
Tbio
Novelty: 0.03470529
Score: 0.545
Data Source: STRINGDB
ASGR1
Tbio
Novelty: 0.0026947
Score: 0.539
Data Source: STRINGDB
PDPN
Tbio
Novelty: 0.0004104
Score: 0.487
Data Source: STRINGDB
CLEC12A
Tbio
Novelty: 0.02175617
Score: 0.486
Data Source: STRINGDB
REG1A
Tbio
Novelty: 0.00122827
Score: 0.468
Data Source: STRINGDB
CLEC14A
Tbio
Novelty: 0.0318057
Score: 0.455
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.91

PubMed score by year
PubTator Score  2.76

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGL
1-70
LFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQ
70-140
WKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWL
140-210
WMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
210-280
MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD