You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
RTBDN
Retbindin

Protein Summary
Description
Riboflavin-binding protein which might have a role in retinal flavin transport. This gene was first identified in a study of human eye tissues. The protein encoded by this gene is preferentially expressed in the retina and may play a role in binding retinoids and other carotenoids as it shares homology with riboflavin binding proteins. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000322912
  • ENSP00000326253
  • ENSG00000132026
  • ENST00000393233
  • ENSP00000376925
  • ENST00000458671
  • ENSP00000416375
  • ENST00000592204
  • ENSP00000466765
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.76
kinase perturbation
0.76
transcription factor
0.6
cell line
0.56
chemical
0.43


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.67   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 40   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.67   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 40   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (19)
1 – 10 of 19
GAS6
Tbio
Novelty: 0.00291371
p_int: 0.999996352
p_ni: 0.000003645
p_wrong: 2e-9
Score: 0.201
Data Source: BioPlex,STRINGDB
ZER1
Tbio
Novelty: 0.05686147
p_int: 0.993503721
p_ni: 0.006496278
Score: 0.189
Data Source: BioPlex,STRINGDB
TTC19
Tbio
Novelty: 0.09680022
p_int: 0.986419244
p_ni: 0.013580756
Score: 0.163
Data Source: BioPlex,STRINGDB
COL6A1
Tbio
Novelty: 0.00861534
p_int: 0.952019363
p_ni: 0.047980637
Score: 0.201
Data Source: BioPlex,STRINGDB
AMD1
Tchem
Family: Enzyme
Novelty: 0.00107659
p_int: 0.924104667
p_ni: 0.075895331
p_wrong: 2e-9
Score: 0.179
Data Source: BioPlex,STRINGDB
UBAC1
Tbio
Novelty: 0.00195339
p_int: 0.808997297
p_ni: 0.115236777
p_wrong: 0.075765926
Score: 0.185
Data Source: BioPlex,STRINGDB
TSEN2
Tbio
Family: Enzyme
Novelty: 0.10246402
p_int: 0.776948047
p_ni: 0.223051952
p_wrong: 1e-9
Score: 0.201
Data Source: BioPlex,STRINGDB
TTC9B
Tdark
Novelty: 1
Score: 0.584
Data Source: STRINGDB
ERICH1
Tdark
Novelty: 2.22222222
Score: 0.539
Data Source: STRINGDB
TMEM129
Tbio
Family: Enzyme
Novelty: 0.40133779
Score: 0.499
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.67

PubMed score by year
PubTator Score  3.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDCRVHMRPIGLTWVLQLTLAWILLEACGGSRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETS
1-70
GPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLS
70-140
EKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPR
140-210
TSILDAAGSGSGSGSGSGP
210-229
MDCRVHMRPIGLTWVLQLTLAWILLEACGGSRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP