You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MYNN
Myoneurin

Protein Summary
Description
This gene encodes a member of the BTB/POZ and zinc finger domain-containing protein family that are involved in the control of gene expression. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 14. [provided by RefSeq, Jun 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000349841
  • ENSP00000326240
  • ENSG00000085274
  • ENST00000356716
  • ENSP00000349150
  • ENST00000544106
  • ENSP00000440637
  • ENST00000602751
  • ENSP00000473654

Symbol
  • OSZF
  • ZBTB31
  • OSZF
  • SBBIZ1
  • ZBTB31
  • ZNF902
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.98
transcription factor binding site profile
0.97
transcription factor perturbation
0.97
protein domain
0.85
phenotype
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.55   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 221   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.55   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 221   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (35)
1 – 10 of 35
RHPN2
Tbio
Novelty: 0.10708139
Score: 0.743
Data Source: STRINGDB
ACTRT3
Tdark
Novelty: 0.88888889
Score: 0.704
Data Source: STRINGDB
LRRIQ4
Tdark
Novelty: 7
Score: 0.679
Data Source: STRINGDB
LRRC34
Tdark
Novelty: 0.37037037
Score: 0.671
Data Source: STRINGDB
ZNF800
Tdark
Family: TF
Novelty: 4
Score: 0.597
Data Source: STRINGDB
CSRNP2
Tdark
Novelty: 1.32352941
Score: 0.565
Data Source: STRINGDB
NCKAP5L
Tdark
Novelty: 0.59800664
Score: 0.544
Data Source: STRINGDB
LRRC31
Tdark
Novelty: 1.81818182
Score: 0.542
Data Source: STRINGDB
POC1B
Tbio
Novelty: 0.11982426
Score: 0.541
Data Source: STRINGDB
TMBIM4
Tbio
Novelty: 0.01198169
Score: 0.531
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.55

PubMed score by year
PubTator Score  3.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENNVFLDQSQVKA
1-70
DGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAFIANPSSTEISSITGNIELNQ
70-140
QTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTKKKKKAFNSPKTGQNKTVQYPSDILENASVE
140-210
LFLDANKLPTPVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASV
210-280
KSPYEAENSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVR
280-350
THTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRC
350-420
GQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHF
420-490
RSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDM
490-560
TLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY
560-610
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENNVFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAFIANPSSTEISSITGNIELNQQTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTKKKKKAFNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY