You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MYO1D
Unconventional myosin-Id

Protein Summary
Description
Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318217
  • ENSP00000324527
  • ENSG00000176658

Symbol
  • KIAA0727
  • myr4
  • PPP1R108
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
interacting protein
0.9
virus perturbation
0.9
transcription factor binding site profile
0.87
trait
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.83   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 96   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.83   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 96   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (26)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (52)
1 – 10 of 52
PEX19
Tbio
Novelty: 0.00469515
p_int: 0.997856865
p_ni: 0.002143135
Score: 0.169
Data Source: BioPlex,STRINGDB
PSMC4
Tbio
Family: Enzyme
Novelty: 0.02568601
p_int: 0.997515327
p_ni: 0.002484673
Data Source: BioPlex
UBB
Tbio
Novelty: 0.00895161
p_int: 0.987212279
p_ni: 0.012787721
Score: 0.264
Data Source: BioPlex,STRINGDB
DKK3
Tbio
Novelty: 0.00427648
p_int: 0.986229023
p_ni: 0.013770977
Score: 0.296
Data Source: BioPlex,STRINGDB
FBXO40
Tdark
Novelty: 0.2189781
p_int: 0.975867731
p_ni: 0.024132269
Score: 0.189
Data Source: BioPlex,STRINGDB
TOR1AIP2
Tbio
Novelty: 0.17774016
p_int: 0.957510621
p_ni: 0.042489379
Data Source: BioPlex
TBC1D9B
Tdark
Novelty: 2.44186047
p_int: 0.952344016
p_ni: 0.047655984
Score: 0.279
Data Source: BioPlex,STRINGDB
BTD
Tbio
Family: Enzyme
Novelty: 0.02283054
p_int: 0.945770079
p_ni: 0.054229921
Score: 0.239
Data Source: BioPlex,STRINGDB
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.92701575
p_ni: 0.07298425
Data Source: BioPlex
EID1
Tbio
Novelty: 0.01044675
p_int: 0.908910823
p_ni: 0.091089177
Score: 0.392
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  31.83

PubMed score by year
PubTator Score  12.26

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRE
1-70
LYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLK
70-140
SNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQG
140-210
GSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNL
210-280
KFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYER
280-350
LFCWIVTRINDIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ
350-420
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKL
420-490
CASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKR
490-560
PLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQ
560-630
TYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIR
630-700
IVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLR
700-770
RFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT
770-840
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIPLYNLTGLSVS
840-910
NGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHLQVNVTNPVQCSLHGKKCTVS
910-980
VETRLNQPQPDFTKNRSGFILSVPGN
980-1006
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSIIAELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRINDIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLGKHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLRRFEEALQTIFNRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHLQVNVTNPVQCSLHGKKCTVSVETRLNQPQPDFTKNRSGFILSVPGN