You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
OXTR
Oxytocin receptor

Protein Summary
Description
Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The protein encoded by this gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin receptor system plays an important role in the uterus during parturition. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316793
  • ENSP00000324270
  • ENSG00000180914

Symbol
  • OT-R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.98
ligand (chemical)
0.98
biological term
0.95
virus perturbation
0.72
cellular component
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 921.78   (req: < 5)
Gene RIFs: 265   (req: <= 3)
Antibodies: 360   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 921.78   (req: >= 5)
Gene RIFs: 265   (req: > 3)
Antibodies: 360   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 41
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 439
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Pathways (18)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Protein-Protein Interactions (242)
1 – 10 of 242
OXT
Tbio
Novelty: 0.00006195
Score: 0.997
Data Source: Reactome,STRINGDB
AVP
Tbio
Novelty: 0.0001163
Score: 0.984
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.966
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.95
Data Source: STRINGDB
PTGFR
Tclin
Family: GPCR
Novelty: 0.00739575
Score: 0.946
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.945
Data Source: STRINGDB
GNRH2
Tbio
Novelty: 0.00305192
Score: 0.943
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.943
Data Source: STRINGDB
GNRH1
Tbio
Novelty: 0.00024998
Score: 0.935
Data Source: STRINGDB
TRH
Tbio
Novelty: 0.00054889
Score: 0.934
Data Source: STRINGDB
Publication Statistics
PubMed Score  921.78

PubMed score by year
PubTator Score  576.96

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACVLLALRTTRQK
1-70
HSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLA
70-140
ICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYI
140-210
VPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFII
210-280
VLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSAS
280-350
YLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA
350-389
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACVLLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA