You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SOX2
Transcription factor SOX-2

Protein Summary
Description
Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206 (By similarity). Critical for early embryogenesis and for embryonic stem cell pluripotency. May function as a switch in neuronal development. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity). Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation (By similarity). This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000325404
  • ENSP00000323588
  • ENSG00000181449

Symbol
  • ANOP3
  • MCOPS3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
gene perturbation
0.92
PubMedID
0.88
molecular function
0.81
phenotype
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1853.65   (req: < 5)
Gene RIFs: 490   (req: <= 3)
Antibodies: 1595   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1853.65   (req: >= 5)
Gene RIFs: 490   (req: > 3)
Antibodies: 1595   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 38
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Deactivation of the beta-catenin transactivating complex
Reactome
Developmental Biology
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Deactivation of the beta-catenin transactivating complex
Developmental Biology
Gene expression (Transcription)
Generic Transcription Pathway
Gene Ontology Terms (44)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (555)
1 – 10 of 555
SOX21
Tbio
Family: TF
Novelty: 0.02532074
p_int: 1
Score: 0.695
Data Source: BioPlex,STRINGDB
SOX14
Tbio
Family: TF
Novelty: 0.0540498
p_int: 1
Score: 0.475
Data Source: BioPlex,STRINGDB
RBP1
Tbio
Novelty: 0.00214416
p_int: 0.997151973
p_ni: 0.002840178
p_wrong: 0.000007849
Score: 0.444
Data Source: BioPlex,STRINGDB
PLPBP
Tbio
Family: Enzyme
Novelty: 0.0468506
p_int: 0.996418182
p_ni: 0.000839887
p_wrong: 0.00274193
Score: 0.189
Data Source: BioPlex,STRINGDB
FAHD2A
Tdark
Family: Enzyme
Novelty: 0.68965517
p_int: 0.990797849
p_ni: 0.009202146
p_wrong: 5e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
PRTFDC1
Tbio
Family: Enzyme
Novelty: 0.15441176
p_int: 0.985019062
p_ni: 0.004077268
p_wrong: 0.01090367
Score: 0.201
Data Source: BioPlex,STRINGDB
SERPINB1
Tbio
Family: Enzyme
Novelty: 0.00240968
p_int: 0.984018306
p_ni: 0.015981694
Score: 0.201
Data Source: BioPlex,STRINGDB
ENPP4
Tbio
Family: Enzyme
Novelty: 0.16683217
p_int: 0.978190109
p_ni: 0.000146229
p_wrong: 0.021663661
Score: 0.163
Data Source: BioPlex,STRINGDB
OXSM
Tbio
Family: Enzyme
Novelty: 0.01304348
p_int: 0.963482236
p_ni: 0.036480067
p_wrong: 0.000037697
Score: 0.197
Data Source: BioPlex,STRINGDB
PAK2
Tchem
Family: Kinase
Novelty: 0.01124372
p_int: 0.950063292
p_ni: 0.049936698
p_wrong: 9e-9
Score: 0.191
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1853.65

PubMed score by year
PubTator Score  1381.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE
1-70
ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA
70-140
SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM
140-210
TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG
210-280
AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM
280-317
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM