You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
FAM187B
Protein FAM187B

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324675
  • ENSP00000323355
  • ENSG00000177558

Symbol
  • TMEM162
  • TMEM162
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phenotype
0.56
trait
0.46
cell line
0.42
tissue
0.41
disease
0.38


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.08   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 40   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.08   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 40   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (34)
1 – 10 of 34
MOSPD2
Tbio
Novelty: 0.27833002
p_int: 0.99998349
p_ni: 0.00001651
Score: 0.175
Data Source: BioPlex,STRINGDB
SOAT1
Tchem
Family: Enzyme
Novelty: 0.00668517
p_int: 0.995721892
p_ni: 0.004278106
p_wrong: 2e-9
Score: 0.185
Data Source: BioPlex,STRINGDB
SLC25A6
Tbio
Family: Transporter
Novelty: 0.00749136
p_int: 0.975128989
p_ni: 0.024871011
Score: 0.204
Data Source: BioPlex,STRINGDB
CANX
Tbio
Novelty: 0.00135361
p_int: 0.970122775
p_ni: 0.029877225
Data Source: BioPlex
RPL23
Tbio
Novelty: 0.02634055
p_int: 0.95741539
p_ni: 0.04258461
Data Source: BioPlex
TUBA1A
Tchem
Novelty: 0.0159455
p_int: 0.949460084
p_ni: 0.050539916
Data Source: BioPlex
VRK2
Tbio
Family: Kinase
Novelty: 0.04234495
p_int: 0.880563869
p_ni: 0.119436131
Score: 0.204
Data Source: BioPlex,STRINGDB
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.873693012
p_ni: 0.126306988
Data Source: BioPlex
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.849929948
p_ni: 0.150070052
Data Source: BioPlex
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.772348704
p_ni: 0.227651296
Data Source: BioPlex
Publication Statistics
PubMed Score  1.08

PubMed score by year
PubTator Score  1.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPPMLWLLLHFAAPALGFYFSISCPSGKQCQQALLSGNDILLYCNSSGAHWYYLFTQGKKGRLTSLTNIS
1-70
NMEIMPEGSLLIKDPLPSQTGLYHCWNKNGRQVVQYEIDFQDVTTLHITHKDLGQRPLQNETLHLGSKQL
70-140
IFTWWEPWQDCNRCEEPGECKRLGYRYIEEPLEEAMPCWLYLGEVLVWSSRLRPELQVEACHVQCTNNTQ
140-210
LRVDYVIFDNFRLDEKTEFVWLDCPLGSMYRPVNWRANDTPLTWESQLSGQDFTTFLDPSTGGRQLQVFQ
210-280
PAVYKCFVQQELVAQFKPAASLETLEAQWRENDAQWREARKALRGRADSVLKGLKLVLLVVTVLALLGAL
280-350
LKCIHPSPGRRSTQVLVVK
350-369
MPPMLWLLLHFAAPALGFYFSISCPSGKQCQQALLSGNDILLYCNSSGAHWYYLFTQGKKGRLTSLTNISNMEIMPEGSLLIKDPLPSQTGLYHCWNKNGRQVVQYEIDFQDVTTLHITHKDLGQRPLQNETLHLGSKQLIFTWWEPWQDCNRCEEPGECKRLGYRYIEEPLEEAMPCWLYLGEVLVWSSRLRPELQVEACHVQCTNNTQLRVDYVIFDNFRLDEKTEFVWLDCPLGSMYRPVNWRANDTPLTWESQLSGQDFTTFLDPSTGGRQLQVFQPAVYKCFVQQELVAQFKPAASLETLEAQWRENDAQWREARKALRGRADSVLKGLKLVLLVVTVLALLGALLKCIHPSPGRRSTQVLVVK