You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MMP1
Interstitial collagenase

Protein Summary
Description
Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X (PubMed:2557822, PubMed:2153297, PubMed:1645757). In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity (PubMed:16807369). This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COP ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000315274
  • ENSP00000322788
  • ENSG00000196611

Symbol
  • CLG
  • CLG
  • CLGN
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
disease
1
gene perturbation
1
protein domain
1
chemical
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2729.25   (req: < 5)
Gene RIFs: 727   (req: <= 3)
Antibodies: 1051   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2729.25   (req: >= 5)
Gene RIFs: 727   (req: > 3)
Antibodies: 1051   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1453
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (15)
1 – 5 of 15
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (44)
Activation of Matrix Metalloproteinases (R-HSA-1592389)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of Matrix Metalloproteinases
Reactome
Basigin interactions
Reactome
Cell surface interactions at the vascular wall
Reactome
Collagen degradation
Reactome
Cytokine Signaling in Immune system
Name
Explore in Pharos
Explore in Source
Activation of Matrix Metalloproteinases
Basigin interactions
Cell surface interactions at the vascular wall
Collagen degradation
Cytokine Signaling in Immune system
Protein-Protein Interactions (203)
1 – 10 of 203
TIMP1
Tbio
Family: Enzyme
Novelty: 0.00025759
Score: 0.994
Data Source: STRINGDB
BSG
Tbio
Novelty: 0.00077805
Score: 0.984
Data Source: Reactome,STRINGDB
ACAN
Tbio
Novelty: 0.00041383
Score: 0.98
Data Source: STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.966
Data Source: STRINGDB
MMP9
Tchem
Family: Enzyme
Novelty: 0.00010127
Score: 0.961
Data Source: Reactome,STRINGDB
PLG
Tclin
Family: Enzyme
Novelty: 0.00005824
Score: 0.96
Data Source: STRINGDB
IGFBP3
Tchem
Novelty: 0.00042672
Score: 0.959
Data Source: Reactome,STRINGDB
CMA1
Tchem
Family: Enzyme
Novelty: 0.00089798
Score: 0.953
Data Source: STRINGDB
MMP3
Tchem
Novelty: 0.00050371
Score: 0.953
Data Source: STRINGDB
IGF1
Tbio
Novelty: 0.00004544
Score: 0.945
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  2729.25

PubMed score by year
PubTator Score  3100.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
1-70
FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL
70-140
WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY
140-210
NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS
210-280
KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA
280-350
VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
350-420
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
420-469
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN