You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FGF8
Fibroblast growth factor 8

Protein Summary
Description
Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (PubMed:16384934, PubMed:16597617, PubMed:8663044). Plays a role in neurite outgrowth in hippocampal cells (PubMed:21576111). The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted t ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000320185
  • ENSP00000321797
  • ENSG00000107831
  • ENST00000344255
  • ENSP00000340039
  • ENST00000346714
  • ENSP00000344306
  • ENST00000347978
  • ENSP00000321945

Symbol
  • AIGF
  • HH6
  • AIGF
  • KAL6
  • FGF-8
  • HBGF-8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
transcription factor
0.76
PubMedID
0.74
transcription factor binding site profile
0.68
tissue
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 548.91   (req: < 5)
Gene RIFs: 44   (req: <= 3)
Antibodies: 377   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 548.91   (req: >= 5)
Gene RIFs: 44   (req: > 3)
Antibodies: 377   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 68
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (206)
Activated point mutants of FGFR2 (R-HSA-2033519)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 74
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated point mutants of FGFR2
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Name
Explore in Pharos
Explore in Source
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
Gene Ontology Terms (71)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (368)
1 – 10 of 368
TTC30A
Tdark
Novelty: 4
p_int: 0.999988124
p_ni: 0.000011876
Score: 0.208
Data Source: BioPlex,STRINGDB
IFT80
Tbio
Novelty: 0.07705762
p_int: 0.999940408
p_ni: 0.000048383
p_wrong: 0.000011209
Score: 0.239
Data Source: BioPlex,STRINGDB
IFT88
Tbio
Novelty: 0.00935043
p_int: 0.999867026
p_ni: 0.00013227
p_wrong: 7.04e-7
Score: 0.481
Data Source: BioPlex,STRINGDB
FAM91A1
Tbio
Novelty: 1.09090909
p_int: 0.999829608
p_ni: 0.000170392
Data Source: BioPlex
IFT52
Tbio
Novelty: 0.06710552
p_int: 0.999135873
p_ni: 0.000863968
p_wrong: 1.59e-7
Score: 0.218
Data Source: BioPlex,STRINGDB
IFT57
Tbio
Novelty: 0.04669088
p_int: 0.998214697
p_ni: 0.000323447
p_wrong: 0.001461856
Score: 0.166
Data Source: BioPlex,STRINGDB
IFT81
Tbio
Novelty: 0.00856499
p_int: 0.998029565
p_ni: 0.001970435
Data Source: BioPlex
HIST1H1T
Tdark
Novelty: 0.01211318
p_int: 0.997684961
p_ni: 0.002315039
Score: 0.177
Data Source: BioPlex,STRINGDB
ANKHD1
Tbio
Novelty: 0.08323329
p_int: 0.997326923
p_ni: 0.002673077
Data Source: BioPlex
YTHDC2
Tbio
Family: Enzyme
Novelty: 0.18840993
p_int: 0.994958846
p_ni: 0.005041154
Data Source: BioPlex
Publication Statistics
PubMed Score  548.91

PubMed score by year
PubTator Score  243.65

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIR
1-70
TYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNG
70-140
KGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFE
140-210
FLNYPPFTRSLRGSQRTWAPEPR
210-233
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR