You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WIPF2
WAS/WASL-interacting protein family member 2

Protein Summary
Description
Plays an active role in the formation of cell surface protrusions downstream of activated PDGFB receptors. Plays an important role in actin-microspike formation through cooperation with WASL. May cooperate with WASP and WASL to induce mobilization and reorganization of the actin filament system. This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000323571
  • ENSP00000320924
  • ENSG00000171475
  • ENST00000583130
  • ENSP00000462350
  • ENST00000585043
  • ENSP00000462826

Symbol
  • WICH
  • WIRE
  • WICH
  • WIRE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease
0.99
disease perturbation
0.99
histone modification site profile
0.9
virus perturbation
0.88
transcription factor binding site profile
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.59   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 148   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.59   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 148   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Fcgamma receptor (FCGR) dependent phagocytosis (R-HSA-2029480)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fcgamma receptor (FCGR) dependent phagocytosis
Reactome
Immune System
Reactome
Innate Immune System
Reactome
RHO GTPase Effectors
Reactome
RHO GTPases Activate WASPs and WAVEs
Name
Explore in Pharos
Explore in Source
Fcgamma receptor (FCGR) dependent phagocytosis
Immune System
Innate Immune System
RHO GTPase Effectors
RHO GTPases Activate WASPs and WAVEs
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (75)
1 – 10 of 75
NCK1
Tbio
Novelty: 0.00554007
p_int: 0.999999996
p_ni: 4e-9
Score: 0.959
Data Source: BioPlex,Reactome,STRINGDB
NCK2
Tbio
Novelty: 0.02908657
p_int: 0.999999992
p_ni: 8e-9
Score: 0.798
Data Source: BioPlex,STRINGDB
GRB2
Tchem
Novelty: 0.00060543
p_int: 0.99999999
p_ni: 1e-8
Score: 0.601
Data Source: BioPlex,Reactome,STRINGDB
WASL
Tbio
Novelty: 0.00386851
p_int: 0.999999985
p_ni: 1.4e-8
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
PACSIN2
Tbio
Family: Enzyme
Novelty: 0.03915066
p_int: 0.9956836
p_ni: 0.002590812
p_wrong: 0.001725588
Score: 0.543
Data Source: BioPlex,STRINGDB
WAS
Tbio
Novelty: 0.00072185
Score: 0.994
Data Source: Reactome,STRINGDB
WASF1
Tbio
Novelty: 0.00071484
Score: 0.972
Data Source: STRINGDB
ACTR2
Tbio
Novelty: 0.01032806
Score: 0.956
Data Source: STRINGDB
ACTR3
Tbio
Novelty: 0.03429716
Score: 0.942
Data Source: STRINGDB
CDC42
Tchem
Family: Enzyme
Novelty: 0.00039759
Score: 0.942
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  104.59

PubMed score by year
PubTator Score  5.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGS
1-70
SGGYGSGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDS
70-140
SRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLP
140-210
PTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRH
210-280
NSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHG
280-350
SEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI
350-420
YPSKTNRAARGAPPLPPILR
420-440
MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGSSGGYGSGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRIYPSKTNRAARGAPPLPPILR