You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
P2RY13
P2Y purinoceptor 13

Protein Summary
Description
Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system. The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is activated by ADP. [provided by RefSeq, Sep 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000325602
  • ENSP00000320376
  • ENSG00000181631

Symbol
  • GPR86
  • GPR94
  • GPCR1
  • GPR86
  • GPR94
  • P2Y13
  • SP174
  • FKSG77
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.7
gene perturbation
0.65
tissue sample
0.59
ligand (chemical)
0.56
tissue
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.05   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 339   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 27.05   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 339   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 12
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (21)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Nucleotide-like (purinergic) receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Nucleotide-like (purinergic) receptors
Protein-Protein Interactions (273)
1 – 10 of 273
TMIGD3
Tchem
Novelty: 0.00111452
Score: 0.966
Data Source: STRINGDB
ADORA3
Tchem
Family: GPCR
Novelty: 0.00111452
Score: 0.966
Data Source: STRINGDB
TAS2R16
Tbio
Family: GPCR
Novelty: 0.03546057
Score: 0.96
Data Source: STRINGDB
TAS2R38
Tbio
Family: GPCR
Novelty: 0.00547147
Score: 0.951
Data Source: STRINGDB
ADORA1
Tclin
Family: GPCR
Novelty: 0.0005245
Score: 0.95
Data Source: STRINGDB
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
Score: 0.936
Data Source: STRINGDB
CX3CR1
Tchem
Family: GPCR
Novelty: 0.00138659
Score: 0.933
Data Source: STRINGDB
P2RY14
Tchem
Family: GPCR
Novelty: 0.02096508
Score: 0.931
Data Source: STRINGDB
CXCR1
Tchem
Family: GPCR
Novelty: 0.00285279
Score: 0.931
Data Source: STRINGDB
FPR1
Tchem
Family: GPCR
Novelty: 0.00150161
Score: 0.93
Data Source: STRINGDB
Publication Statistics
PubMed Score  27.05

PubMed score by year
PubTator Score  27.54

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFV
1-70
HIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFD
70-140
RFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVN
140-210
NICQFIFWTVFILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTH
210-280
SQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDN
280-350
ITLG
350-354
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG