You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PINX1
PIN2/TERF1-interacting telomerase inhibitor 1

Protein Classes
Protein Summary
Description
Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000314787
  • ENSP00000318966
  • ENSG00000254093
  • ENST00000519088
  • ENSP00000428853

Symbol
  • LPTL
  • LPTS
  • Gno1
  • LPTL
  • LPTS
  • Pxr1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.9
trait
0.86
histone modification site profile
0.82
cellular component
0.81
biological process
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 111.47   (req: < 5)
Gene RIFs: 48   (req: <= 3)
Antibodies: 211   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 111.47   (req: >= 5)
Gene RIFs: 48   (req: > 3)
Antibodies: 211   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (181)
1 – 10 of 181
TERF1
Tbio
Family: TF
Novelty: 0.00225772
p_int: 0.999999951
p_ni: 4.6e-8
p_wrong: 3e-9
Score: 0.898
Data Source: BioPlex,STRINGDB
FBL
Tbio
Family: Enzyme
Novelty: 0.00044932
p_int: 0.999060618
p_ni: 0.000939382
Score: 0.835
Data Source: BioPlex,STRINGDB
NOCT
Tbio
Novelty: 0.01352299
p_int: 0.972707836
p_ni: 0.027290677
p_wrong: 0.000001488
Data Source: BioPlex
FXR1
Tbio
Novelty: 0.01773466
p_int: 0.945056657
p_ni: 0.054943343
Score: 0.228
Data Source: BioPlex,STRINGDB
FAM98A
Tdark
Novelty: 0.32846715
p_int: 0.924463354
p_ni: 0.075536646
Score: 0.26
Data Source: BioPlex,STRINGDB
SNRNP70
Tbio
Novelty: 0.00199593
p_int: 0.91832747
p_ni: 0.081010601
p_wrong: 0.000661929
Score: 0.159
Data Source: BioPlex,STRINGDB
EAF1
Tbio
Novelty: 0.86956522
p_int: 0.904524488
p_ni: 0.09512205
p_wrong: 0.000353462
Data Source: BioPlex
WDYHV1
Tdark
Family: Enzyme
Novelty: 0.23412216
p_int: 0.892385142
p_ni: 0.107316911
p_wrong: 0.000297947
Data Source: BioPlex
DGCR8
Tbio
Novelty: 0.00319395
p_int: 0.857470847
p_ni: 0.1421385
p_wrong: 0.000390653
Data Source: BioPlex
RPL8
Tbio
Novelty: 0.03315002
p_int: 0.80834217
p_ni: 0.19165783
Score: 0.176
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  111.47

PubMed score by year
PubTator Score  66.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGAT
1-70
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSK
70-140
TDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERK
140-210
RGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDH
210-280
VQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK
280-328
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK