You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ROCK2
Rho-associated protein kinase 2

Protein Summary
Description
Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000315872
  • ENSP00000317985
  • ENSG00000134318

Symbol
  • KIAA0619
  • ROCK-II
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
molecular function
0.99
kinase perturbation
0.91
biological process
0.84
transcription factor binding site profile
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 329.27   (req: < 5)
Gene RIFs: 143   (req: <= 3)
Antibodies: 625   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 329.27   (req: >= 5)
Gene RIFs: 143   (req: > 3)
Antibodies: 625   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 56
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 814
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Approved Drugs (3)
1 – 3 of 3
ripasudil
chemical structure image
fasudil
chemical structure image
netarsudil
chemical structure image
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (60)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 18
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
EPH-Ephrin signaling
Reactome
EPHA-mediated growth cone collapse
Reactome
EPHB-mediated forward signaling
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPHB-mediated forward signaling
Gene Ontology Terms (61)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Non-traceable Author Statement (NAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (169)
1 – 10 of 169
POLR1C
Tbio
Family: Enzyme
Novelty: 0.02674163
p_int: 0.999999973
p_ni: 2.7e-8
Score: 0.208
Data Source: BioPlex,STRINGDB
ROCK1
Tclin
Family: Kinase
Novelty: 0.00196146
p_int: 0.999999679
p_ni: 3.3e-8
p_wrong: 2.89e-7
Score: 0.987
Data Source: BioPlex,STRINGDB
DNAJB11
Tbio
Novelty: 0.02382365
p_int: 0.999998186
p_ni: 0.000001814
Score: 0.254
Data Source: BioPlex,STRINGDB
FBXO42
Tbio
Novelty: 0.01292089
p_int: 0.999775981
p_ni: 0.000224019
Score: 0.318
Data Source: BioPlex,STRINGDB
LRPAP1
Tbio
Novelty: 0.0018518
p_int: 0.999636482
p_ni: 0.000363144
p_wrong: 3.73e-7
Score: 0.214
Data Source: BioPlex,STRINGDB
ADD2
Tbio
Family: Enzyme
Novelty: 0.00893667
p_int: 0.989967403
p_ni: 0.009995901
p_wrong: 0.000036696
Score: 0.774
Data Source: BioPlex,STRINGDB
RHOA
Tbio
Family: Enzyme
Novelty: 0.0002729
Score: 0.995
Data Source: Reactome,STRINGDB
PPP1R12A
Tbio
Family: Enzyme
Novelty: 0.00135446
Score: 0.992
Data Source: Reactome,STRINGDB
CDC5L
Tbio
Family: TF
Novelty: 0.00617757
Score: 0.986
Data Source: STRINGDB
RHOC
Tbio
Family: Enzyme
Novelty: 0.00407673
Score: 0.979
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  329.27

PubMed score by year
PubTator Score  224.71

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDN
1-70
FLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEE
70-140
RDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGL
140-210
IHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSV
210-280
GVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQ
280-350
HPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
350-420
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITL
420-490
RKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQL
490-560
QRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSALESE
560-630
RRDRTHGSEIINDLQGRICGLEEDLKNGKILLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQS
630-700
LEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQ
700-770
SQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
770-840
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQKKQELQDERDS
840-910
LAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNRTLTS
910-980
DVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKR
980-1050
GNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLR
1050-1120
SQLQALHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQD
1120-1190
KEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
1190-1260
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLL
1260-1330
ANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
1330-1388
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKILLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQKKQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS