Tbio CD209 CD209 antigen

Protein Classes

PANTHER Classes

Protein / Receptor / Cytokine Receptor / Immunoglobulin Receptor Superfamily / Cd209 Antigen

Protein / Defense/immunity Protein / Immunoglobulin Receptor Superfamily / Cd209 Antigen

Protein / Cell Adhesion Molecule / Cd209 Antigen

DTO Classes

Protein / Receptor / Cytokine Receptor / Immunoglobulin Receptor Superfamily / Cd209 Antigen

Protein Summary

Description

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells. (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2. (Microbial infection) Acts as an attachment receptor for Ebolavirus. (Microbial infection) Acts as an attachment receptor for Cytomegalovirus. (Microbial infection) Acts as an attachment receptor for HCV. (Microbial infection) Acts as an attachment receptor for Dengue virus. (Microbial infection) Acts as an attachment receptor for Measles virus. (Microbial infection) Acts as an attachment receptor for Herpes simplex virus 1. (Microbial infection) Acts as an attachment receptor for Influenzavirus A. (Microbial infection) Acts as an attachment receptor for SARS coronavirus. (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus. (Microbial infection) Acts as an attachment receptor for Lassa virus (PubMed:23966408). Acts as an attachment receptor for Marburg virusn. (Microbial infection) Acts as an attachment receptor for Respiratory syncytial virus. (Microbial infection) Acts as an attachment receptor for Rift valley fever virus and uukuniemi virus. (Microbial infection) Acts as an attachment receptor for West-nile virus. (Microbial infection) Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of bacterial pathogen antigens, including Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA (PubMed:16379498). Recognition of M.tuberculosis by dendritic cells occurs partially via this molecule (PubMed:16092920, PubMed:21203928). This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.[provided by RefSeq, Feb 2009]

Uniprot Accession IDs

• Q9NNX6
• A8KAM4
• A8MVQ9
• G5E9C4
• Q2TB19
• Q96QP7
• Q96QP8
• Q96QP9
• Q96QQ0
• Q96QQ1
• Q96QQ2
• Q96QQ3
• Q96QQ4
• Q96QQ5
• Q96QQ6
• Q96QQ7
• Q96QQ8

Gene Name

• CD209

Ensembl ID

• ENST00000204801
• ENSP00000204801
• ENSG00000090659
• ENST00000315591
• ENSP00000315407
• ENST00000315599
• ENSP00000315477
• ENST00000354397
• ENSP00000346373
• ENST00000394161
• ENSP00000377716
• ENST00000601256
• ENSP00000470658
• ENST00000601951
• ENSP00000468827
• ENST00000602261
• ENSP00000471137

Symbol

• CLEC4L
• CDSIGN
• CLEC4L
• DC-SIGN
• DC-SIGN1

Knowledge Table

Most Knowledge About	Knowledge Value (0 to 1 scale)
biological term	0.99
cellular component	0.82
cell type or tissue	0.77
phenotype	0.67
gene perturbation	0.6

IDG Development Level Summary

Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 749.2   (req: < 5)

Gene RIFs: 270   (req: <= 3)

Antibodies: 1369   (req: <= 50)

Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 749.2   (req: >= 5)

Gene RIFs: 270   (req: > 3)

Antibodies: 1369   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23

Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0

Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0

Protein Data Bank (8)

1 – 5 of 8

PDB Structure Id	Ligand	Method	Resolution (Å)	M.W. (kDa)	Pub Year	Title

PDB Structure Id	M.W.	Resolution	Pub Year

Pathways (11)

Reactome (6)

KEGG (4)

WikiPathways (1)

Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:

5

1 – 5 of 6

Data Source	Name	Explore in Pharos	Explore in Source
Reactome	Adaptive Immune System	894 targets	R-HSA-1280218
Reactome	Butyrophilin (BTN) family interactions	12 targets	R-HSA-8851680
Reactome	C-type lectin receptors (CLRs)	144 targets	R-HSA-5621481
Reactome	CD209 (DC-SIGN) signaling	21 targets	R-HSA-5621575
Reactome	Immune System	2246 targets	R-HSA-168256

Name	Explore in Pharos	Explore in Source
Adaptive Immune System	894 targets	R-HSA-1280218
Butyrophilin (BTN) family interactions	12 targets	R-HSA-8851680
C-type lectin receptors (CLRs)	144 targets	R-HSA-5621481
CD209 (DC-SIGN) signaling	21 targets	R-HSA-5621575
Immune System	2246 targets	R-HSA-168256

Gene Ontology Terms (31)

Functions (6)

Components (8)

Processes (17)

Items per page:

10

1 – 6 of 6

GO Term	Evidence	Assigned by
mannose binding	Traceable Author Statement (TAS)	UniProtKB
virion binding	Traceable Author Statement (TAS)	UniProtKB
carbohydrate binding	Non-traceable Author Statement (NAS)	UniProtKB
peptide antigen binding	Non-traceable Author Statement (NAS)	UniProtKB
metal ion binding	Inferred from Electronic Annotation (IEA)	UniProtKB-KW
virus receptor activity	Inferred from Electronic Annotation (IEA)	UniProtKB-KW

Protein-Protein Interactions (127)

Explore Interacting Targets

1 – 10 of 127

• See Interactions on String-DB

CLEC4M

Tbio

Novelty: 0.01055864

p_int: 1

Score: 0.904

Data Source: BioPlex,STRINGDB

FAM217B

Tdark

Novelty: 3

p_int: 0.999998966

p_ni: 0.000001012

p_wrong: 2.3e-8

Score: 0.221

Data Source: BioPlex,STRINGDB

HTR1B

Tclin

Family: GPCR

Novelty: 0.00089155

p_int: 0.999614359

p_wrong: 0.00038564

Score: 0.689

Data Source: BioPlex,STRINGDB

HMGCR

Tclin

Family: Enzyme

Novelty: 0.00056109

p_int: 0.91367529

p_ni: 0.08632471

Score: 0.345

Data Source: BioPlex,STRINGDB

ZNF703

Tbio

Novelty: 0.05197807

p_int: 0.811260758

p_ni: 0.18873923

p_wrong: 1.2e-8

Score: 0.187

Data Source: BioPlex,STRINGDB

ICAM3

Tbio

Novelty: 0.00219774

Score: 0.997

Data Source: Reactome,STRINGDB

ICAM2

Tbio

Novelty: 0.00637658

Score: 0.982

Data Source: Reactome,STRINGDB

BTN2A1

Tbio

Novelty: 0.03671686

Score: 0.932

Data Source: Reactome,STRINGDB

LSP1

Tbio

Novelty: 0.01170291

Score: 0.92

Data Source: STRINGDB

RAF1

Tclin

Family: Kinase

Novelty: 0.00165174

Score: 0.908

Data Source: STRINGDB

Publication Statistics

PubMed Score  749.20

PubMed score by year

Reset Zoom

PubTator Score  301.43

PubTator score by year

Reset Zoom

Amino Acid Sequence

Residue Counts

Sequence

MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQE

1-70

QSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEK

70-140

SKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKS

140-210

KQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDS

210-280

ITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNN

280-350

VGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

350-404

MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Find similar targets by:

Uniprot Keyword

3D-structure
Adaptive immunity
Alternative splicing
Calcium
Cell adhesion
Cell membrane
Complete proteome
Disulfide bond
Endocytosis
Glycoprotein