You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD209
CD209 antigen

Protein Summary
Description
Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells. (Microbial infection) Acts as an attachment receptor for HIV-1 and HIV-2. (Microbial infection) Acts as an attachment receptor for Ebolavirus. (Microbial infection) Acts as an atta ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000204801
  • ENSP00000204801
  • ENSG00000090659
  • ENST00000315591
  • ENSP00000315407
  • ENST00000315599
  • ENSP00000315477
  • ENST00000354397
  • ENSP00000346373
  • ENST00000394161
  • ENSP00000377716
  • ENST00000601256
  • ENSP00000470658
  • ENST00000601951
  • ENSP00000468827
  • ENST00000602261
  • ENSP00000471137

Symbol
  • CLEC4L
  • CDSIGN
  • CLEC4L
  • DC-SIGN
  • DC-SIGN1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.99
cellular component
0.82
cell type or tissue
0.77
phenotype
0.67
gene perturbation
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 749.2   (req: < 5)
Gene RIFs: 270   (req: <= 3)
Antibodies: 1369   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 749.2   (req: >= 5)
Gene RIFs: 270   (req: > 3)
Antibodies: 1369   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Butyrophilin (BTN) family interactions
Reactome
C-type lectin receptors (CLRs)
Reactome
CD209 (DC-SIGN) signaling
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Butyrophilin (BTN) family interactions
C-type lectin receptors (CLRs)
CD209 (DC-SIGN) signaling
Immune System
Gene Ontology Terms (31)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (127)
1 – 10 of 127
CLEC4M
Tbio
Novelty: 0.01055864
p_int: 1
Score: 0.904
Data Source: BioPlex,STRINGDB
FAM217B
Tdark
Novelty: 3
p_int: 0.999998966
p_ni: 0.000001012
p_wrong: 2.3e-8
Score: 0.221
Data Source: BioPlex,STRINGDB
HTR1B
Tclin
Family: GPCR
Novelty: 0.00089155
p_int: 0.999614359
p_wrong: 0.00038564
Score: 0.689
Data Source: BioPlex,STRINGDB
HMGCR
Tclin
Family: Enzyme
Novelty: 0.00056109
p_int: 0.91367529
p_ni: 0.08632471
Score: 0.345
Data Source: BioPlex,STRINGDB
ZNF703
Tbio
Novelty: 0.05197807
p_int: 0.811260758
p_ni: 0.18873923
p_wrong: 1.2e-8
Score: 0.187
Data Source: BioPlex,STRINGDB
ICAM3
Tbio
Novelty: 0.00219774
Score: 0.997
Data Source: Reactome,STRINGDB
ICAM2
Tbio
Novelty: 0.00637658
Score: 0.982
Data Source: Reactome,STRINGDB
BTN2A1
Tbio
Novelty: 0.03671686
Score: 0.932
Data Source: Reactome,STRINGDB
LSP1
Tbio
Novelty: 0.01170291
Score: 0.92
Data Source: STRINGDB
RAF1
Tclin
Family: Kinase
Novelty: 0.00165174
Score: 0.908
Data Source: STRINGDB
Publication Statistics
PubMed Score  749.20

PubMed score by year
PubTator Score  301.43

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQE
1-70
QSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEK
70-140
SKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKS
140-210
KQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDS
210-280
ITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNN
280-350
VGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
350-404
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA