You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
IL1RAP
Interleukin-1 receptor accessory protein

Protein Summary
Description
Coreceptor for IL1RL2 in the IL-36 signaling system (By similarity). Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Coreceptor for IL1RL1 in the IL-33 signaling system. Can bidirectionally induce pre- and postsynaptic differentiation of neurons by trans-synaptically binding to PTPRD (By similarity). May play a role in IL1B-mediated costimulation of IFNG production fr ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000072516
  • ENSP00000072516
  • ENSG00000196083
  • ENST00000317757
  • ENSP00000314807
  • ENST00000342550
  • ENSP00000345829
  • ENST00000412504
  • ENSP00000412053
  • ENST00000413869
  • ENSP00000416296
  • ENST00000422485
  • ENSP00000409352
  • ENST00000422940
  • ENSP00000387371
  • ENST00000439062
  • ENSP00000401132
  • ENST00000443369
  • ENSP00000408893
  • ENST00000447382
  • ENSP00000390541

Symbol
  • C3orf13
  • IL1R3
  • IL1R3
  • C3orf13
  • IL-1RAcP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
trait
0.93
transcription factor perturbation
0.88
protein domain
0.85
gene perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 54.61   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 363   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 54.61   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 363   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
anakinra
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (117)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-1 family signaling
Reactome
Interleukin-1 signaling
Reactome
Interleukin-33 signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-1 family signaling
Interleukin-1 signaling
Interleukin-33 signaling
Protein-Protein Interactions (62)
1 – 10 of 62
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.998589128
p_ni: 0.000287548
p_wrong: 0.001123324
Score: 0.23
Data Source: BioPlex,STRINGDB
PCDHA12
Tdark
Novelty: 4
p_int: 0.985442291
p_ni: 0.014294126
p_wrong: 0.000263583
Score: 0.189
Data Source: BioPlex,STRINGDB
PCDHGB4
Tdark
Novelty: 0.62001206
p_int: 0.985442291
p_ni: 0.014294126
p_wrong: 0.000263583
Score: 0.179
Data Source: BioPlex,STRINGDB
IL1B
Tclin
Novelty: 0.00003644
Score: 0.997
Data Source: Reactome,STRINGDB
IL1R1
Tclin
Novelty: 0.00195105
Score: 0.991
Data Source: Reactome,STRINGDB
IRAK1
Tchem
Family: Kinase
Novelty: 0.00254228
Score: 0.975
Data Source: Reactome,STRINGDB
MYD88
Tbio
Novelty: 0.00054413
Score: 0.972
Data Source: Reactome,STRINGDB
TRAF6
Tbio
Novelty: 0.00159491
Score: 0.968
Data Source: Reactome,STRINGDB
TOLLIP
Tbio
Novelty: 0.01304711
Score: 0.965
Data Source: Reactome,STRINGDB
IL1A
Tchem
Novelty: 0.00027442
Score: 0.963
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  54.61

PubMed score by year
PubTator Score  69.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW
1-70
YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS
70-140
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY
140-210
TCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV
210-280
WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK
280-350
VPAPRYTVELACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
350-420
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENM
420-490
ASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQ
490-560
GLSYSSLKNV
560-570
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQGLSYSSLKNV