You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CA5B
Carbonic anhydrase 5B, mitochondrial

Protein Summary
Description
Reversible hydration of carbon dioxide. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes carbonic anhydrase 5B. CA5B, and the related CA5A gene, has its expression localized in the mitochondria though CA5B has a wider tissue distribution than CA5A, which is restricted to the liver, kidneys, and skeletal muscle. A carbonic anhydrase pseudogene (CA5BP1) is adjacent to the CA5B gene and these two loci produce CA5BP1-CA5B readthrough transcripts. [provided by RefSeq, Jan 2019]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318636
  • ENSP00000314099
  • ENSG00000169239
  • ENST00000454127
  • ENSP00000417021

Symbol
  • CAVB
  • CA-VB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.93
virus perturbation
0.85
histone modification site profile
0.82
microRNA
0.75
small molecule perturbation
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 234.39   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 229   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 234.39   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 229   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 86
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 15
Pathways (4)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Reversible hydration of carbon dioxide
Name
Explore in Pharos
Explore in Source
Metabolism
Reversible hydration of carbon dioxide
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (35)
1 – 10 of 35
DBT
Tbio
Family: Enzyme
Novelty: 0.0041813
p_int: 0.859884806
p_ni: 0.140115193
p_wrong: 1e-9
Score: 0.297
Data Source: BioPlex,STRINGDB
CYP24A1
Tchem
Family: Enzyme
Novelty: 0.00108437
Score: 0.836
Data Source: STRINGDB
UHMK1
Tbio
Family: Kinase
Novelty: 0.00180095
Score: 0.7
Data Source: STRINGDB
THRSP
Tbio
Novelty: 0.00422168
Score: 0.676
Data Source: STRINGDB
BCLAF3
Tdark
Novelty: 0.875
Score: 0.66
Data Source: STRINGDB
SNRPB
Tbio
Novelty: 0.01137048
Score: 0.589
Data Source: STRINGDB
SLC4A4
Tbio
Family: Transporter
Novelty: 0.00221797
Score: 0.578
Data Source: STRINGDB
PM20D2
Tdark
Family: Enzyme
Novelty: 0.90909091
Score: 0.571
Data Source: STRINGDB
SLC9A1
Tchem
Family: Transporter
Novelty: 0.00112175
Score: 0.57
Data Source: STRINGDB
TAB3
Tbio
Family: Enzyme
Novelty: 0.03300472
Score: 0.56
Data Source: STRINGDB
Publication Statistics
PubMed Score  234.39

PubMed score by year
PubTator Score  33.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIR
1-70
WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWG
70-140
SEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALV
140-210
EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDN
210-280
FRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
280-317
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP