You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CC2D1A
Coiled-coil and C2 domain-containing protein 1A

Protein Summary
Description
Transcription factor that binds specifically to the DRE (dual repressor element) and represses HTR1A gene transcription in neuronal cells. The combination of calcium and ATP specifically inactivates the binding with FRE. May play a role in the altered regulation of HTR1A associated with anxiety and major depression. Mediates HDAC-independent repression of HTR1A promoter in neuronal cell. Performs essential function in controlling functional maturation of synapses (By similarity). Plays distinct roles depending on its localization. When cytoplasmic, acts as a scaffold protein in the PI3K/PDK1/AKT pathway. Repressor of HTR1A when nuclear. In the centrosome, regulates spindle pole localization of the cohesin subunit SCC1/RAD21, thereby mediating centriole cohesion during mitosis. This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5'-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA bindi ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318003
  • ENSP00000313601
  • ENSG00000132024
  • ENST00000589606
  • ENSP00000467526

Symbol
  • AKI1
  • MRT3
  • FREUD-1
  • Freud-1/Aki1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.89
molecular function
0.81
cellular component
0.69
transcription factor
0.68
biological process
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 53.45   (req: < 5)
Gene RIFs: 28   (req: <= 3)
Antibodies: 148   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 53.45   (req: >= 5)
Gene RIFs: 28   (req: > 3)
Antibodies: 148   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (58)
1 – 10 of 58
CAV1
Tbio
Novelty: 0.00041332
p_int: 0.999999818
p_ni: 1.82e-7
Data Source: BioPlex
TSPAN3
Tbio
Novelty: 0.15112361
p_int: 0.999997388
p_ni: 0.000002611
p_wrong: 1e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
SLC1A1
Tchem
Family: Transporter
Novelty: 0.00252834
p_int: 0.99999014
p_ni: 0.000005717
p_wrong: 0.000004143
Data Source: BioPlex
TMEM159
Tdark
Novelty: 0.36363636
p_int: 0.999973509
p_ni: 0.00002647
p_wrong: 2.1e-8
Data Source: BioPlex
CRYAB
Tbio
Novelty: 0.00547363
p_int: 0.999870657
p_ni: 0.000121434
p_wrong: 0.000007909
Score: 0.205
Data Source: BioPlex,STRINGDB
MRAP2
Tbio
Novelty: 0.05863056
p_int: 0.99979664
p_ni: 0.000200173
p_wrong: 0.000003186
Data Source: BioPlex
CRYAA
Tbio
Novelty: 0.03207592
p_int: 0.998667658
p_ni: 0.000585219
p_wrong: 0.000747122
Data Source: BioPlex
CHMP4A
Tbio
Novelty: 0.01746823
Score: 0.874
Data Source: STRINGDB
CHMP4C
Tbio
Novelty: 0.1149268
Score: 0.82
Data Source: STRINGDB
PRSS12
Tbio
Novelty: 0.03177005
Score: 0.756
Data Source: STRINGDB
Publication Statistics
PubMed Score  53.45

PubMed score by year
PubTator Score  26.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPM
1-70
EAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTL
70-140
QERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPA
140-210
PTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDT
210-280
TAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLE
280-350
ALEQRMERYQVAAAQAKSKGDQRKARMHERIVKQYQDAIRAHKAGRAVDVAELPVPPGFPPIQGLEATKP
350-420
TQQSLVGVLETAMKLANQDEGPEDEEDEVPKKQNSPVAPTAQPKAPPSRTPQSGSAPTAKAPPKATSTRA
420-490
QQQLAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNGLPVDITKVPPAPVNKDDFAL
490-560
VQRPGPGLSQEAARRYGELTKLIRQQHEMCLNHSNQFTQLGNITETTKFEKLAEDCKRSMDILKQAFVRG
560-630
LPTPTARFEQRTFSVIKIFPDLSSNDMLLFIVKGINLPTPPGLSPGDLDVFVRFDFPYPNVEEAQKDKTS
630-700
VIKNTDSPEFKEQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDALEIACEVREI
700-770
LEVLDGRRPTGGRLEVMVRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKGKAPPVPAPARESGNR
770-840
SARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRREYAAQLE
840-910
RQLQFYTEAARRLGNDGSRDAAKEALYRRNLVESELQRLRR
910-951
MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLEALEQRMERYQVAAAQAKSKGDQRKARMHERIVKQYQDAIRAHKAGRAVDVAELPVPPGFPPIQGLEATKPTQQSLVGVLETAMKLANQDEGPEDEEDEVPKKQNSPVAPTAQPKAPPSRTPQSGSAPTAKAPPKATSTRAQQQLAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNGLPVDITKVPPAPVNKDDFALVQRPGPGLSQEAARRYGELTKLIRQQHEMCLNHSNQFTQLGNITETTKFEKLAEDCKRSMDILKQAFVRGLPTPTARFEQRTFSVIKIFPDLSSNDMLLFIVKGINLPTPPGLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFKEQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDALEIACEVREILEVLDGRRPTGGRLEVMVRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKGKAPPVPAPARESGNRSARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRREYAAQLERQLQFYTEAARRLGNDGSRDAAKEALYRRNLVESELQRLRR