Protein Classes
Protein Summary
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placenta ...more
- ENST00000323322
- ENSP00000312673
- ENSG00000259384
- ENST00000351388
- ENSP00000343791
- ENST00000458650
- ENSP00000408486
- GH
- GHN
- GH-N
- GHB5
- IGHD2
- hGH-N
- IGHD1A
- IGHD1B
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
chemical | 0.94 | ||
disease | 0.9 | ||
biological process | 0.88 | ||
phenotype | 0.75 | ||
biological term | 0.64 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1063.35 (req: < 5)
Gene RIFs: 337 (req: <= 3)
Antibodies: 1244 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1063.35 (req: >= 5)
Gene RIFs: 337 (req: > 3)
Antibodies: 1244 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 21
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (92)
Reactome (7)
KEGG (4)
PathwayCommons (7)
WikiPathways (74)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 7
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cytokine Signaling in Immune system | ||||
Reactome | Growth hormone receptor signaling | ||||
Reactome | Immune System | ||||
Reactome | Metabolism of proteins | ||||
Reactome | Peptide hormone metabolism | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cytokine Signaling in Immune system | ||||
Growth hormone receptor signaling | ||||
Immune System | ||||
Metabolism of proteins | ||||
Peptide hormone metabolism | ||||
Gene Ontology Terms (25)
Functions (5)
Components (4)
Processes (16)
Items per page:
10
1 – 5 of 5
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | MGI | |||
Inferred from Direct Assay (IDA) | AgBase | |||
Inferred from Physical Interaction (IPI) | BHF-UCL | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (128)
1 – 10 of 128
CSH1
Novelty: 0.00110788
p_int: 1
Score: 0.976
Data Source: BioPlex,Reactome,STRINGDB
GHR
Novelty: 0.00119399
Score: 0.996
Data Source: Reactome,STRINGDB
PRLR
Novelty: 0.00161333
Score: 0.992
Data Source: Reactome,STRINGDB
PRL
Novelty: 0.00010121
Score: 0.954
Data Source: Reactome,STRINGDB
SOCS2
Novelty: 0.00459272
Score: 0.949
Data Source: Reactome,STRINGDB
STAT5B
Family: TF
Novelty: 0.00091216
Score: 0.938
Data Source: Reactome,STRINGDB
JAK2
Family: Kinase
Novelty: 0.00028252
Score: 0.937
Data Source: Reactome,STRINGDB
STAT5A
Family: TF
Novelty: 0.00091229
Score: 0.933
Data Source: Reactome,STRINGDB
CISH
Novelty: 0.00075253
Score: 0.929
Data Source: Reactome,STRINGDB
SOCS3
Novelty: 0.00082008
Score: 0.926
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score 1063.35
PubMed score by year
PubTator Score 20218.03
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSF
1-70
LQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL
70-140
KDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRS
140-210
VEGSCGF
210-217
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Find similar targets by: