You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GH1
Somatotropin

Protein Summary
Description
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues. The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placenta ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000323322
  • ENSP00000312673
  • ENSG00000259384
  • ENST00000351388
  • ENSP00000343791
  • ENST00000458650
  • ENSP00000408486

Symbol
  • GH
  • GHN
  • GH-N
  • GHB5
  • IGHD2
  • hGH-N
  • IGHD1A
  • IGHD1B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
0.94
disease
0.9
biological process
0.88
phenotype
0.75
biological term
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1063.35   (req: < 5)
Gene RIFs: 337   (req: <= 3)
Antibodies: 1244   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1063.35   (req: >= 5)
Gene RIFs: 337   (req: > 3)
Antibodies: 1244   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (92)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Growth hormone receptor signaling
Reactome
Immune System
Reactome
Metabolism of proteins
Reactome
Peptide hormone metabolism
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Growth hormone receptor signaling
Immune System
Metabolism of proteins
Peptide hormone metabolism
Protein-Protein Interactions (128)
1 – 10 of 128
CSH1
Tbio
Novelty: 0.00110788
p_int: 1
Score: 0.976
Data Source: BioPlex,Reactome,STRINGDB
GHR
Tclin
Novelty: 0.00119399
Score: 0.996
Data Source: Reactome,STRINGDB
PRLR
Tbio
Novelty: 0.00161333
Score: 0.992
Data Source: Reactome,STRINGDB
PRL
Tbio
Novelty: 0.00010121
Score: 0.954
Data Source: Reactome,STRINGDB
SOCS2
Tbio
Novelty: 0.00459272
Score: 0.949
Data Source: Reactome,STRINGDB
STAT5B
Tchem
Family: TF
Novelty: 0.00091216
Score: 0.938
Data Source: Reactome,STRINGDB
JAK2
Tclin
Family: Kinase
Novelty: 0.00028252
Score: 0.937
Data Source: Reactome,STRINGDB
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
Score: 0.933
Data Source: Reactome,STRINGDB
CISH
Tbio
Novelty: 0.00075253
Score: 0.929
Data Source: Reactome,STRINGDB
SOCS3
Tbio
Novelty: 0.00082008
Score: 0.926
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  1063.35

PubMed score by year
PubTator Score  20218.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSF
1-70
LQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL
70-140
KDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRS
140-210
VEGSCGF
210-217
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF