You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LEP
Leptin

Protein Summary
Description
Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways (PubMed:17344214, PubMed:15899045, PubMed:19688109). In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity (By similarity) (PubMed:8589726, PubMed:11460888, PubMed:19688109, PubMed:24340098, PubMed:25060689). In the arcuate nucleus of the hypothalamus, activates by depolarization POMC ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308868
  • ENSP00000312652
  • ENSG00000174697

Symbol
  • OB
  • OBS
  • OB
  • OBS
  • LEPD
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
gene perturbation
0.98
disease
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16848.93   (req: < 5)
Gene RIFs: 1453   (req: <= 3)
Antibodies: 1365   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16848.93   (req: >= 5)
Gene RIFs: 1453   (req: > 3)
Antibodies: 1365   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 93
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (70)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Incretin synthesis, secretion, and inactivation
Reactome
Metabolism of proteins
Reactome
Peptide hormone metabolism
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Developmental Biology
Incretin synthesis, secretion, and inactivation
Metabolism of proteins
Peptide hormone metabolism
Signal Transduction
Gene Ontology Terms (96)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (533)
1 – 10 of 533
LEPR
Tclin
Novelty: 0.00091043
p_int: 0.99999993
p_ni: 7e-8
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
GLB1L
Tdark
Family: Enzyme
Novelty: 1.81959565
p_int: 0.996501188
p_ni: 0.001306635
p_wrong: 0.002192178
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.852172792
p_ni: 0.147827208
Score: 0.617
Data Source: BioPlex,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.992
Data Source: Reactome,STRINGDB
PPARG
Tclin
Family: NR
Novelty: 0.00012454
Score: 0.991
Data Source: STRINGDB
SOCS3
Tbio
Novelty: 0.00082008
Score: 0.989
Data Source: Reactome,STRINGDB
GCG
Tchem
Novelty: 0.00005614
Score: 0.989
Data Source: STRINGDB
JAK2
Tclin
Family: Kinase
Novelty: 0.00028252
Score: 0.984
Data Source: Reactome,STRINGDB
IRS1
Tbio
Novelty: 0.00061858
Score: 0.982
Data Source: Reactome,STRINGDB
CRP
Tbio
Novelty: 0.0000246
Score: 0.981
Data Source: STRINGDB
Publication Statistics
PubMed Score  16848.93

PubMed score by year
PubTator Score  6553.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPIL
1-70
TLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY
70-140
STEVVALSRLQGSLQDMLWQLDLSPGC
140-167
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC