You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PTPN2
Tyrosine-protein phosphatase non-receptor type 2

Protein Summary
Description
Non-receptor type tyrosine-specific phosphatase that dephosphorylates receptor protein tyrosine kinases including INSR, EGFR, CSF1R, PDGFR. Also dephosphorylates non-receptor protein tyrosine kinases like JAK1, JAK2, JAK3, Src family kinases, STAT1, STAT3 and STAT6 either in the nucleus or the cytoplasm. Negatively regulates numerous signaling pathways and biological processes like hematopoiesis, inflammatory response, cell proliferation and differentiation, and glucose homeostasis. Plays a multifaceted and important role in the development of the immune system. Functions in T-cell receptor signaling through dephosphorylation of FYN and LCK to control T-cells differentiation and activation. Dephosphorylates CSF1R, negatively regulating its downstream signaling and macrophage differentiation. Negatively regulates cytokine (IL2/interleukin-2 and interferon)-mediated signaling through dephosphorylation of the cytoplasmic kinases JAK1, JAK3 and their substrate STAT1, that propagate signali ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309660
  • ENSP00000311857
  • ENSG00000175354
  • ENST00000327283
  • ENSP00000320298
  • ENST00000353319
  • ENSP00000320546
  • ENST00000591115
  • ENSP00000466936

Symbol
  • PTPT
  • PTN2
  • PTPT
  • TCPTP
  • TC-PTP
  • TCELLPTP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
virus perturbation
1
disease perturbation
0.99
trait
0.93
transcription factor binding site profile
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 343.55   (req: < 5)
Gene RIFs: 90   (req: <= 3)
Antibodies: 251   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 343.55   (req: >= 5)
Gene RIFs: 90   (req: > 3)
Antibodies: 251   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 40
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 162
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (28)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interferon Signaling
Reactome
Interferon gamma signaling
Reactome
Interleukin-1 family signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interferon Signaling
Interferon gamma signaling
Interleukin-1 family signaling
Gene Ontology Terms (46)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (128)
1 – 10 of 128
C5AR2
Tbio
Family: GPCR
Novelty: 0.01354267
p_int: 0.999997695
p_ni: 0.000002305
Data Source: BioPlex
COL5A1
Tbio
Novelty: 0.0078384
p_int: 0.999994591
p_ni: 0.000005125
p_wrong: 2.85e-7
Score: 0.455
Data Source: BioPlex,STRINGDB
B4GAT1
Tbio
Family: Enzyme
Novelty: 0.06386176
p_int: 0.999987921
p_ni: 0.000012078
p_wrong: 1e-9
Score: 0.151
Data Source: BioPlex,STRINGDB
C3AR1
Tchem
Family: GPCR
Novelty: 0.00700844
p_int: 0.999902414
p_ni: 0.000092607
p_wrong: 0.00000498
Data Source: BioPlex
ASGR1
Tbio
Novelty: 0.0026947
p_int: 0.999845072
p_ni: 0.000154861
p_wrong: 6.7e-8
Score: 0.324
Data Source: BioPlex,STRINGDB
SLC39A4
Tbio
Family: Transporter
Novelty: 0.00826526
p_int: 0.999813723
p_ni: 0.000173269
p_wrong: 0.000013007
Data Source: BioPlex
CTLA4
Tclin
Novelty: 0.00017405
p_int: 0.999548269
p_ni: 0.000151122
p_wrong: 0.000300609
Score: 0.448
Data Source: BioPlex,STRINGDB
TNFSF18
Tbio
Novelty: 0.01752002
p_int: 0.999353018
p_ni: 0.000117263
p_wrong: 0.000529719
Data Source: BioPlex
TNFSF8
Tbio
Novelty: 0.01609818
p_int: 0.991008382
p_ni: 0.001431142
p_wrong: 0.007560477
Data Source: BioPlex
SLC39A5
Tbio
Family: Transporter
Novelty: 0.06778122
p_int: 0.978564106
p_ni: 0.00099235
p_wrong: 0.020443544
Data Source: BioPlex
Publication Statistics
PubMed Score  343.55

PubMed score by year
PubTator Score  193.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYIN
1-70
ASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG
70-140
FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHG
140-210
PAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIK
210-280
GDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALR
280-350
KRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
350-415
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL