You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GSTM1
Glutathione S-transferase Mu 1

Protein Summary
Description
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this clas ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309851
  • ENSP00000311469
  • ENSG00000134184
  • ENST00000349334
  • ENSP00000234981

Symbol
  • GST1
  • MU
  • H-B
  • GST1
  • GTH4
  • GTM1
  • MU-1
  • GSTM1-1
  • GSTM1a-1a
  • GSTM1b-1b
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
chemical
1
transcription factor perturbation
1
PubMedID
0.9
virus perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2517.16   (req: < 5)
Gene RIFs: 1205   (req: <= 3)
Antibodies: 561   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2517.16   (req: >= 5)
Gene RIFs: 1205   (req: > 3)
Antibodies: 561   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Glutathione conjugation
Reactome
Metabolism
Reactome
Phase II - Conjugation of compounds
Name
Explore in Pharos
Explore in Source
Biological oxidations
Glutathione conjugation
Metabolism
Phase II - Conjugation of compounds
Protein-Protein Interactions (133)
1 – 10 of 133
HAUS7
Tbio
Novelty: 1.2
p_int: 0.966240587
p_ni: 0.033739815
p_wrong: 0.000019599
Data Source: BioPlex
ARL6IP6
Tdark
Novelty: 0.43010753
p_int: 0.951871269
p_ni: 0.048114168
p_wrong: 0.000014563
Score: 0.21
Data Source: BioPlex,STRINGDB
DAO
Tchem
Family: Enzyme
Novelty: 0.00368338
p_int: 0.950067884
p_ni: 0.049843029
p_wrong: 0.000089087
Score: 0.648
Data Source: BioPlex,STRINGDB
CYP1A1
Tchem
Novelty: 0.00028982
Score: 0.962
Data Source: STRINGDB
GSTM2
Tchem
Family: Enzyme
Novelty: 0.00495564
Score: 0.96
Data Source: STRINGDB
CYP2E1
Tchem
Novelty: 0.00037342
Score: 0.927
Data Source: STRINGDB
EPHX1
Tchem
Family: Enzyme
Novelty: 0.00210581
Score: 0.927
Data Source: STRINGDB
GGH
Tchem
Family: Enzyme
Novelty: 0.00341456
Score: 0.905
Data Source: STRINGDB
GSTO2
Tbio
Family: Enzyme
Novelty: 0.02293247
Score: 0.898
Data Source: STRINGDB
GSTO1
Tchem
Family: Enzyme
Novelty: 0.00873007
Score: 0.888
Data Source: STRINGDB
Publication Statistics
PubMed Score  2517.16

PubMed score by year
PubTator Score  1778.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI
1-70
TQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSE
70-140
FLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFS
140-210
KMAVWGNK
210-218
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK