You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
VEGFB
Vascular endothelial growth factor B

Protein Summary
Description
Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis. This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309422
  • ENSP00000311127
  • ENSG00000173511
  • ENST00000426086
  • ENSP00000401550

Symbol
  • VRF
  • VRF
  • VEGFL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
kinase perturbation
0.88
tissue sample
0.79
gene perturbation
0.76
small molecule perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 268.08   (req: < 5)
Gene RIFs: 44   (req: <= 3)
Antibodies: 560   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 268.08   (req: >= 5)
Gene RIFs: 44   (req: > 3)
Antibodies: 560   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 32
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
aflibercept
no chemical structure image available
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (31)
Hemostasis (R-HSA-109582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Reactome
Platelet degranulation
Reactome
Response to elevated platelet cytosolic Ca2+
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Hemostasis
Platelet activation, signaling and aggregation
Platelet degranulation
Response to elevated platelet cytosolic Ca2+
Signal Transduction
Gene Ontology Terms (36)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (122)
1 – 10 of 122
TRIM68
Tbio
Family: Enzyme
Novelty: 0.27820711
p_int: 0.999911489
p_ni: 0.000088511
Score: 0.163
Data Source: BioPlex,STRINGDB
ADAM21
Tdark
Family: Enzyme
Novelty: 0.17571384
p_int: 0.999896768
p_ni: 0.000020752
p_wrong: 0.00008248
Score: 0.167
Data Source: BioPlex,STRINGDB
VEGFA
Tclin
Novelty: 0.00004909
p_int: 0.999876188
p_ni: 9.61e-7
p_wrong: 0.000122851
Score: 0.958
Data Source: BioPlex,STRINGDB
LY86
Tbio
Novelty: 0.00136228
p_int: 0.999636023
p_ni: 0.000041017
p_wrong: 0.00032296
Data Source: BioPlex
HAL
Tbio
Family: Enzyme
Novelty: 0.00925623
p_int: 0.907466923
p_ni: 0.092533066
p_wrong: 1.1e-8
Score: 0.169
Data Source: BioPlex,STRINGDB
NUDT16L1
Tbio
Novelty: 0.01808227
p_int: 0.750814652
p_ni: 0.249185348
Score: 0.282
Data Source: BioPlex,STRINGDB
FLT1
Tclin
Family: Kinase
Novelty: 0.00037168
Score: 0.999
Data Source: Reactome,STRINGDB
KDR
Tclin
Family: Kinase
Novelty: 0.00019671
Score: 0.953
Data Source: STRINGDB
EGF
Tbio
Novelty: 0.00015623
Score: 0.941
Data Source: STRINGDB
HGF
Tchem
Family: Enzyme
Novelty: 0.00042012
Score: 0.937
Data Source: STRINGDB
Publication Statistics
PubMed Score  268.08

PubMed score by year
PubTator Score  165.24

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP
1-70
SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT
70-140
PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA
140-207
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA