You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CASP3
Caspase-3

Protein Summary
Description
Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage. The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308394
  • ENSP00000311032
  • ENSG00000164305
  • ENST00000523916
  • ENSP00000428929

Symbol
  • CPP32
  • CPP32
  • SCA-1
  • CPP32B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
chemical
1
hub protein
1
protein domain
0.92
pathway
0.89


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20417.92   (req: < 5)
Gene RIFs: 716   (req: <= 3)
Antibodies: 2221   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 20417.92   (req: >= 5)
Gene RIFs: 716   (req: > 3)
Antibodies: 2221   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 60
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 787
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (100)
1 – 5 of 100
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (127)
Activation of caspases through apoptosome-mediated cleavage (R-HSA-111459)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 29
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of caspases through apoptosome-mediated cleavage
Reactome
Apoptosis
Reactome
Apoptosis induced DNA fragmentation
Reactome
Apoptotic cleavage of cell adhesion proteins
Reactome
Apoptotic cleavage of cellular proteins
Name
Explore in Pharos
Explore in Source
Activation of caspases through apoptosome-mediated cleavage
Apoptosis
Apoptosis induced DNA fragmentation
Apoptotic cleavage of cell adhesion proteins
Apoptotic cleavage of cellular proteins
Gene Ontology Terms (67)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (854)
1 – 10 of 854
XIAP
Tchem
Family: Enzyme
Novelty: 0.00068225
p_int: 0.99956311
p_ni: 0.000436886
p_wrong: 4e-9
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ERP44
Tbio
Novelty: 0.02934854
p_int: 0.883099705
p_ni: 0.116900295
Score: 0.205
Data Source: BioPlex,STRINGDB
LSM14B
Tdark
Novelty: 0.32065776
p_int: 0.817297021
p_ni: 0.182702797
p_wrong: 1.82e-7
Score: 0.241
Data Source: BioPlex,STRINGDB
SLC35A1
Tbio
Family: Transporter
Novelty: 0.02585992
p_int: 0.804339891
p_ni: 0.195659774
p_wrong: 3.35e-7
Score: 0.359
Data Source: BioPlex,STRINGDB
KCNA10
Tclin
Family: IC
Novelty: 0.07392631
p_int: 0.800333514
p_ni: 0.199666226
p_wrong: 2.6e-7
Score: 0.2
Data Source: BioPlex,STRINGDB
MED20
Tbio
Family: Enzyme
Novelty: 0.02451628
p_int: 0.777274371
p_ni: 0.215565616
p_wrong: 0.007160013
Data Source: BioPlex
CASP8
Tchem
Family: Enzyme
Novelty: 0.00026844
Score: 0.999
Data Source: STRINGDB
APAF1
Tbio
Family: Enzyme
Novelty: 0.00164778
Score: 0.998
Data Source: STRINGDB
CYCS
Tchem
Novelty: 0.00018258
Score: 0.995
Data Source: STRINGDB
PARP1
Tclin
Family: Enzyme
Novelty: 0.00042675
Score: 0.99
Data Source: STRINGDB
Publication Statistics
PubMed Score  20417.92

PubMed score by year
PubTator Score  15240.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD
1-70
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT
70-140
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK
140-210
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
210-277
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH