Protein Classes
Protein Summary
Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage. The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is ...more
- ENST00000308394
- ENSP00000311032
- ENSG00000164305
- ENST00000523916
- ENSP00000428929
- CPP32
- CPP32
- SCA-1
- CPP32B
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
biological process | 1 | ||
chemical | 1 | ||
hub protein | 1 | ||
protein domain | 0.92 | ||
pathway | 0.89 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 20417.92 (req: < 5)
Gene RIFs: 716 (req: <= 3)
Antibodies: 2221 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 20417.92 (req: >= 5)
Gene RIFs: 716 (req: > 3)
Antibodies: 2221 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 60
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 787
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (787)
1 – 10 of 787
Protein Data Bank (100)
1 – 5 of 100
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (127)
Reactome (29)
KEGG (38)
PathwayCommons (23)
WikiPathways (37)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 29
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Activation of caspases through apoptosome-mediated cleavage | ||||
Reactome | Apoptosis | ||||
Reactome | Apoptosis induced DNA fragmentation | ||||
Reactome | Apoptotic cleavage of cell adhesion proteins | ||||
Reactome | Apoptotic cleavage of cellular proteins | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Activation of caspases through apoptosome-mediated cleavage | ||||
Apoptosis | ||||
Apoptosis induced DNA fragmentation | ||||
Apoptotic cleavage of cell adhesion proteins | ||||
Apoptotic cleavage of cellular proteins | ||||
Gene Ontology Terms (67)
Functions (12)
Components (7)
Processes (48)
Items per page:
10
1 – 10 of 12
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Experiment (EXP) | Reactome | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Mutant Phenotype (IMP) | UniProtKB | |||
Inferred from Mutant Phenotype (IMP) | UniProtKB | |||
Traceable Author Statement (TAS) | Reactome | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Protein-Protein Interactions (854)
1 – 10 of 854
XIAP
Family: Enzyme
Novelty: 0.00068225
p_int: 0.99956311
p_ni: 0.000436886
p_wrong: 4e-9
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ERP44
Novelty: 0.02934854
p_int: 0.883099705
p_ni: 0.116900295
Score: 0.205
Data Source: BioPlex,STRINGDB
LSM14B
Novelty: 0.32065776
p_int: 0.817297021
p_ni: 0.182702797
p_wrong: 1.82e-7
Score: 0.241
Data Source: BioPlex,STRINGDB
SLC35A1
Family: Transporter
Novelty: 0.02585992
p_int: 0.804339891
p_ni: 0.195659774
p_wrong: 3.35e-7
Score: 0.359
Data Source: BioPlex,STRINGDB
KCNA10
Family: IC
Novelty: 0.07392631
p_int: 0.800333514
p_ni: 0.199666226
p_wrong: 2.6e-7
Score: 0.2
Data Source: BioPlex,STRINGDB
MED20
Family: Enzyme
Novelty: 0.02451628
p_int: 0.777274371
p_ni: 0.215565616
p_wrong: 0.007160013
Data Source: BioPlex
CASP8
Family: Enzyme
Novelty: 0.00026844
Score: 0.999
Data Source: STRINGDB
APAF1
Family: Enzyme
Novelty: 0.00164778
Score: 0.998
Data Source: STRINGDB
CYCS
Novelty: 0.00018258
Score: 0.995
Data Source: STRINGDB
PARP1
Family: Enzyme
Novelty: 0.00042675
Score: 0.99
Data Source: STRINGDB
Publication Statistics
PubMed Score 20417.92
PubMed score by year
PubTator Score 15240.84
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD
1-70
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT
70-140
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK
140-210
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
210-277
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Find similar targets by: