You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CLTB
Clathrin light chain B

Protein Summary
Description
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000310418
  • ENSP00000309415
  • ENSG00000175416
  • ENST00000345807
  • ENSP00000310812

Symbol
  • LCB
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
transcription factor perturbation
0.94
interacting protein
0.8
PubMedID
0.77
transcription factor binding site profile
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 216.33   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 204   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 216.33   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 204   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (46)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Beta-catenin independent WNT signaling
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Developmental Biology
Name
Explore in Pharos
Explore in Source
Axon guidance
Beta-catenin independent WNT signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Developmental Biology
Gene Ontology Terms (20)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (254)
1 – 10 of 254
CLTCL1
Tbio
Novelty: 0.05165674
Score: 0.997
Data Source: Reactome,STRINGDB
CLTC
Tbio
Novelty: 0.00348813
Score: 0.997
Data Source: Reactome,STRINGDB
GAK
Tchem
Family: Kinase
Novelty: 0.01252746
Score: 0.988
Data Source: STRINGDB
HIP1R
Tbio
Novelty: 0.03034966
Score: 0.988
Data Source: STRINGDB
AP2A1
Tbio
Novelty: 0.19889503
Score: 0.983
Data Source: Reactome,STRINGDB
EPS15
Tbio
Novelty: 0.00518368
Score: 0.979
Data Source: STRINGDB
HIP1
Tbio
Novelty: 0.01839478
Score: 0.977
Data Source: STRINGDB
AP2M1
Tbio
Novelty: 0.01240983
Score: 0.975
Data Source: Reactome,STRINGDB
DNAJC6
Tbio
Family: Enzyme
Novelty: 0.01725752
Score: 0.974
Data Source: STRINGDB
PICALM
Tbio
Novelty: 0.01012802
Score: 0.973
Data Source: STRINGDB
Publication Statistics
PubMed Score  216.33

PubMed score by year
PubTator Score  88.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT
1-70
TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN
70-140
QRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK
140-210
DVSRLRSVLMSLKQTPLSR
210-229
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR