You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PLG
Plasminogen

Protein Summary
Description
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells. Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo. The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasmin dissolves fibrin in blood clots and is an important protease in many other cellular processes while angiostatin in ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308192
  • ENSP00000308938
  • ENSG00000122194
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
gene perturbation
0.97
biological process
0.82
disease perturbation
0.79
cellular component
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15804.22   (req: < 5)
Gene RIFs: 205   (req: <= 3)
Antibodies: 1218   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15804.22   (req: >= 5)
Gene RIFs: 205   (req: > 3)
Antibodies: 1218   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 27
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 266
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 8
Protein Data Bank (32)
1 – 5 of 32
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (31)
Activation of Matrix Metalloproteinases (R-HSA-1592389)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of Matrix Metalloproteinases
Reactome
Degradation of the extracellular matrix
Reactome
Dissolution of Fibrin Clot
Reactome
Extracellular matrix organization
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Activation of Matrix Metalloproteinases
Degradation of the extracellular matrix
Dissolution of Fibrin Clot
Extracellular matrix organization
Hemostasis
Gene Ontology Terms (37)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
CAFA
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
AgBase
Protein-Protein Interactions (310)
1 – 10 of 310
SLC6A1
Tclin
Family: Transporter
Novelty: 0.0014418
p_int: 0.999982761
p_ni: 0.000009006
p_wrong: 0.000008234
Data Source: BioPlex
FAM32A
Tdark
Novelty: 1.66666667
p_int: 0.855042667
p_ni: 0.144957332
p_wrong: 1e-9
Data Source: BioPlex
SERPINE1
Tchem
Novelty: 0.00020589
Score: 0.998
Data Source: STRINGDB
SERPINF2
Tbio
Novelty: 0.00058646
Score: 0.995
Data Source: Reactome,STRINGDB
PLAUR
Tchem
Family: Enzyme
Novelty: 0.00096649
Score: 0.994
Data Source: Reactome,STRINGDB
HRG
Tbio
Novelty: 0.00347743
Score: 0.992
Data Source: Reactome,STRINGDB
MMP9
Tchem
Family: Enzyme
Novelty: 0.00010127
Score: 0.991
Data Source: STRINGDB
ANXA2
Tbio
Novelty: 0.001218
Score: 0.99
Data Source: STRINGDB
SERPINC1
Tclin
Novelty: 0.00010169
Score: 0.99
Data Source: STRINGDB
SERPINB2
Tbio
Novelty: 0.00223708
Score: 0.987
Data Source: STRINGDB
Publication Statistics
PubMed Score  15804.22

PubMed score by year
PubTator Score  3644.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKE
1-70
QQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPA
70-140
THPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWD
140-210
SQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTG
210-280
ENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIP
280-350
SCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
350-420
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYR
420-490
GKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC
490-560
AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRP
560-630
SSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECF
630-700
ITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKD
700-770
KYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
770-810
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN