You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
QARS
Glutamine--tRNA ligase

Protein Classes
Protein Summary
Description
Glutamine--tRNA ligase (PubMed:26869582). Plays a critical role in brain development (PubMed:24656866). Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a multienzyme complex. Although present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306125
  • ENSP00000307567
  • ENSG00000172053
  • ENST00000414533
  • ENSP00000390015

Symbol
  • GLNRS
  • MSCCA
  • PRO2195
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
interacting protein
0.97
histone modification site profile
0.92
molecular function
0.9
kinase perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.8   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 131   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 42.8   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 131   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL609187
chemical structure image
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Cytosolic tRNA aminoacylation (R-HSA-379716)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytosolic tRNA aminoacylation
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Metabolism of proteins
Reactome
Mitochondrial tRNA aminoacylation
Name
Explore in Pharos
Explore in Source
Cytosolic tRNA aminoacylation
Metabolism
Metabolism of amino acids and derivatives
Metabolism of proteins
Mitochondrial tRNA aminoacylation
Protein-Protein Interactions (281)
1 – 10 of 281
RARS
Tchem
Family: Enzyme
Novelty: 0.00081224
p_int: 0.999747247
p_ni: 0.000252753
Score: 0.999
Data Source: BioPlex,STRINGDB
KARS
Tchem
Family: Enzyme
Novelty: 0.00319409
p_int: 0.996556499
p_ni: 0.003443501
Score: 0.999
Data Source: BioPlex,STRINGDB
EEF1E1
Tbio
Novelty: 0.07766287
p_int: 0.995857055
p_ni: 0.004142945
Score: 0.993
Data Source: BioPlex,STRINGDB
AIMP2
Tbio
Family: Enzyme
Novelty: 0.03974199
p_int: 0.995715384
p_ni: 0.004284616
Score: 0.997
Data Source: BioPlex,STRINGDB
AIMP1
Tbio
Family: Enzyme
Novelty: 0.00828433
p_int: 0.994490591
p_ni: 0.005509409
Score: 0.999
Data Source: BioPlex,STRINGDB
PPM1A
Tchem
Family: Enzyme
Novelty: 0.01918672
p_int: 0.990350133
p_ni: 0.009649867
Score: 0.16
Data Source: BioPlex,STRINGDB
DARS
Tbio
Family: Enzyme
Novelty: 0.01186323
p_int: 0.989075671
p_ni: 0.010924329
Score: 0.997
Data Source: BioPlex,STRINGDB
LARS
Tchem
Family: Enzyme
Novelty: 0.00167582
p_int: 0.979651138
p_ni: 0.020348862
Score: 0.999
Data Source: BioPlex,STRINGDB
EPRS
Tchem
Family: Enzyme
Novelty: 0.00072148
p_int: 0.975918754
p_ni: 0.024081246
Score: 0.998
Data Source: BioPlex,STRINGDB
IARS
Tchem
Family: Enzyme
Novelty: 0.0033571
p_int: 0.962799845
p_ni: 0.037200155
Score: 0.999
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  42.80

PubMed score by year
PubTator Score  58.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLRDTRRLS
1-70
FLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLLVE
70-140
RYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKVAKARLEETDRRTAKDVVEN
140-210
GETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGH
210-280
AKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELI
280-350
RRGLAYVCHQRGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRV
350-420
KYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLH
420-490
YAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDV
490-560
LNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIERTDFKEEPEPGFKRL
560-630
AWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKN
630-700
PEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKE
700-770
DPGKV
770-775
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLRDTRRLSFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLLVERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKVAKARLEETDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRVKYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIERTDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV