You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OGG1
N-glycosylase/DNA lyase

Protein Summary
Description
DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion. This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined. [pro ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302003
  • ENSP00000305584
  • ENSG00000114026
  • ENST00000302008
  • ENSP00000305527
  • ENST00000302036
  • ENSP00000306561
  • ENST00000339511
  • ENSP00000345520
  • ENST00000344629
  • ENSP00000342851
  • ENST00000349503
  • ENSP00000303132
  • ENST00000383826
  • ENSP00000373337
  • ENST00000449570
  • ENSP00000403598

Symbol
  • MMH
  • MUTM
  • OGH1
  • HMMH
  • MUTM
  • OGH1
  • HOGG1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease
0.95
biological process
0.91
molecular function
0.91
disease perturbation
0.87
histone modification site profile
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1888.21   (req: < 5)
Gene RIFs: 426   (req: <= 3)
Antibodies: 428   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1888.21   (req: >= 5)
Gene RIFs: 426   (req: > 3)
Antibodies: 428   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (28)
1 – 5 of 28
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway (R-HSA-5649702)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway
Reactome
Base Excision Repair
Reactome
Base-Excision Repair, AP Site Formation
Reactome
Cleavage of the damaged purine
Reactome
Cleavage of the damaged pyrimidine
Name
Explore in Pharos
Explore in Source
APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway
Base Excision Repair
Base-Excision Repair, AP Site Formation
Cleavage of the damaged purine
Cleavage of the damaged pyrimidine
Gene Ontology Terms (31)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (140)
1 – 10 of 140
APLNR
Tchem
Family: GPCR
Novelty: 0.001441
p_int: 0.880404019
p_ni: 0.000004181
p_wrong: 0.1195918
Score: 0.203
Data Source: BioPlex,STRINGDB
APEX1
Tchem
Family: Enzyme
Novelty: 0.00035132
Score: 0.995
Data Source: Reactome,STRINGDB
NEIL1
Tbio
Family: Enzyme
Novelty: 0.00858522
Score: 0.99
Data Source: Reactome,STRINGDB
NEIL2
Tbio
Family: Enzyme
Novelty: 0.01910769
Score: 0.983
Data Source: STRINGDB
XRCC1
Tbio
Novelty: 0.00094581
Score: 0.968
Data Source: STRINGDB
NTHL1
Tbio
Family: Enzyme
Novelty: 0.0107811
Score: 0.953
Data Source: STRINGDB
MUTYH
Tbio
Family: Enzyme
Novelty: 0.00121993
Score: 0.939
Data Source: STRINGDB
FEN1
Tchem
Family: Enzyme
Novelty: 0.00147856
Score: 0.921
Data Source: STRINGDB
UNG
Tbio
Family: Enzyme
Novelty: 0.0013114
Score: 0.903
Data Source: STRINGDB
XRCC3
Tbio
Novelty: 0.00297925
Score: 0.89
Data Source: STRINGDB
Publication Statistics
PubMed Score  1888.21

PubMed score by year
PubTator Score  908.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE
1-70
EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC
70-140
LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA
140-210
SARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS
210-280
WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG
280-345
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG