Protein Summary
Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. Thi ...more
- ENST00000304749
- ENSP00000305731
- ENSG00000170373
- ENST00000398402
- ENSP00000381439
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
gene perturbation | 0.76 | ||
cell line | 0.73 | ||
cell type or tissue | 0.73 | ||
small molecule perturbation | 0.51 | ||
tissue | 0.44 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 39.93 (req: < 5)
Gene RIFs: 13 (req: <= 3)
Antibodies: 210 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 39.93 (req: >= 5)
Gene RIFs: 13 (req: > 3)
Antibodies: 210 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 2
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (3)
KEGG (1)
WikiPathways (2)
Items per page:
1 – 1 of 1
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
KEGG | Salivary secretion | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Salivary secretion | ||||
Gene Ontology Terms (3)
Functions (1)
Components (1)
Processes (1)
Items per page:
10
1 – 1 of 1
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Traceable Author Statement (TAS) | ProtInc | |||
Protein-Protein Interactions (61)
1 – 10 of 61
CST4
Novelty: 0.010423
p_int: 0.999999322
p_ni: 4.6e-8
p_wrong: 6.32e-7
Score: 0.883
Data Source: BioPlex,STRINGDB
HINT2
Novelty: 0.0404157
p_int: 0.999985029
p_ni: 0.000013918
p_wrong: 0.000001054
Data Source: BioPlex
DDX31
Family: Enzyme
Novelty: 4
p_int: 0.999960755
p_ni: 0.000038204
p_wrong: 0.000001041
Data Source: BioPlex
CTSH
Family: Enzyme
Novelty: 0.00380318
p_int: 0.999935913
p_ni: 0.000064087
Score: 0.348
Data Source: BioPlex,STRINGDB
CMKLR1
Family: GPCR
Novelty: 0.00748603
p_int: 0.999775395
p_ni: 0.000153907
p_wrong: 0.000070698
Data Source: BioPlex
GTF2B
Novelty: 0.00228704
p_int: 0.999729722
p_ni: 0.000270161
p_wrong: 1.17e-7
Score: 0.177
Data Source: BioPlex,STRINGDB
PLEKHG6
Novelty: 0.23008255
p_int: 0.999721734
p_ni: 0.000128559
p_wrong: 0.000149707
Data Source: BioPlex
RHOBTB1
Novelty: 0.04346745
p_int: 0.999712574
p_ni: 0.00028739
p_wrong: 3.6e-8
Data Source: BioPlex
SNRPF
Novelty: 0.22699635
p_int: 0.999599976
p_ni: 0.000399938
p_wrong: 8.7e-8
Data Source: BioPlex
UBTD2
Novelty: 0.21924482
p_int: 0.999445675
p_ni: 0.000554273
p_wrong: 5.2e-8
Score: 0.235
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 39.93
PubMed score by year
PubTator Score 55.82
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRV
1-70
LRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQE
70-140
S
140-141
MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Find similar targets by: