You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TM4SF1
Transmembrane 4 L6 family member 1

Protein Summary
Description
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface antigen and is highly expressed in different carcinomas. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000305366
  • ENSP00000304277
  • ENSG00000169908

Symbol
  • M3S1
  • TAAL6
  • L6
  • H-L6
  • M3S1
  • TAAL6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
gene perturbation
0.95
virus perturbation
0.92
small molecule perturbation
0.9
disease perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.64   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 259   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.64   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 259   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (36)
1 – 10 of 36
CD63
Tchem
Novelty: 0.00112133
Score: 0.715
Data Source: STRINGDB
C1D
Tbio
Novelty: 0.01491795
Score: 0.714
Data Source: STRINGDB
DDR1
Tchem
Family: Kinase
Novelty: 0.00479048
Score: 0.693
Data Source: STRINGDB
TSPAN1
Tbio
Novelty: 0.02017548
Score: 0.67
Data Source: STRINGDB
TSPAN4
Tbio
Novelty: 0.00723614
Score: 0.655
Data Source: STRINGDB
CD53
Tbio
Novelty: 0.02257125
Score: 0.64
Data Source: STRINGDB
MYO10
Tbio
Novelty: 0.02610775
Score: 0.629
Data Source: STRINGDB
CD37
Tbio
Novelty: 0.00976181
Score: 0.628
Data Source: STRINGDB
RHBG
Tbio
Novelty: 0.02238209
Score: 0.627
Data Source: STRINGDB
TSPAN31
Tdark
Novelty: 0.19615058
Score: 0.623
Data Source: STRINGDB
Publication Statistics
PubMed Score  58.64

PubMed score by year
PubTator Score  126.18

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLMLLPAFVFIGL
1-70
EQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYL
70-140
LDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQYDC
140-202
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLMLLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQYDC