You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RNF139
E3 ubiquitin-protein ligase RNF139

Protein Summary
Description
E3-ubiquitin ligase; acts as a negative regulator of the cell proliferation through mechanisms involving G2/M arrest and cell death. Required for MHC class I ubiquitination in cells expressing the cytomegalovirus protein US2 before dislocation from the endoplasmic reticulum (ER). Affects SREBP processing by hindering the SREBP/SCAP complex translocation from the ER to the Golgi, thereby reducing SREBF2 target gene expression. Required for INSIG1 ubiquitination. May be required for EIF3 complex ubiquitination. May function as a signaling receptor. The protein encoded by this gene is a multi-membrane spanning protein containing a RING-H2 finger. This protein is located in the endoplasmic reticulum, and has been shown to possess ubiquitin ligase activity. This gene was found to be interrupted by a t(3:8) translocation in a family with hereditary renal and non-medulary thyroid cancer. Studies of the Drosophila counterpart suggested that this protein may interact with tumor suppressor prote ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000303545
  • ENSP00000304051
  • ENSG00000170881

Symbol
  • TRC8
  • RCA1
  • TRC8
  • HRCA1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.99
transcription factor binding site profile
0.96
histone modification site profile
0.89
disease perturbation
0.83
tissue sample
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.12   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 166   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 17.12   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 166   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Calnexin/calreticulin cycle
Reactome
ER Quality Control Compartment (ERQC)
Reactome
Metabolism of proteins
Reactome
N-glycan trimming in the ER and Calnexin/Calreticulin cycle
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Calnexin/calreticulin cycle
ER Quality Control Compartment (ERQC)
Metabolism of proteins
N-glycan trimming in the ER and Calnexin/Calreticulin cycle
Gene Ontology Terms (22)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (86)
1 – 10 of 86
DERL2
Tbio
Novelty: 0.02848448
Score: 0.97
Data Source: STRINGDB
UBA52
Tbio
Novelty: 0.01006012
Score: 0.97
Data Source: STRINGDB
SEL1L
Tbio
Novelty: 0.01113296
Score: 0.968
Data Source: STRINGDB
OS9
Tbio
Novelty: 0.01598375
Score: 0.967
Data Source: STRINGDB
RPS27A
Tbio
Novelty: 0.01148413
Score: 0.941
Data Source: STRINGDB
HM13
Tbio
Family: Enzyme
Novelty: 0.00293485
Score: 0.936
Data Source: STRINGDB
UBC
Tbio
Novelty: 0.00161137
Score: 0.935
Data Source: STRINGDB
UBB
Tbio
Novelty: 0.00895161
Score: 0.935
Data Source: STRINGDB
UBE2G2
Tbio
Novelty: 0.05545031
Score: 0.933
Data Source: STRINGDB
DERL1
Tbio
Novelty: 0.0156695
Score: 0.907
Data Source: STRINGDB
Publication Statistics
PubMed Score  17.12

PubMed score by year
PubTator Score  20.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLFGVFASSIVLI
1-70
LSQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIG
70-140
YVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLLFTSSLILTLNTVFVLAVKLKWFYYSTRYVYL
140-210
LVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNL
210-280
IISGCDSTLTVLGMSAVISSVAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLI
280-350
RLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWL
350-420
FAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYYVRSTGSIIEFIFGVVMFGNGAYTMMFE
420-490
SGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARI
490-560
TPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELN
560-630
EDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
630-664
MAAVGPPQQQVRMAHQQVWAALEVALRVPCLYIIDAIFNSYPDSSQSRFCIVLQIFLRLFGVFASSIVLILSQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIGYVTLLQIHSIYSQLIILDLLVPVIGLITELPLHIRETLLFTSSLILTLNTVFVLAVKLKWFYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRVTAQATVLMYILRMANETDSFFISWDDFWDLICNLIISGCDSTLTVLGMSAVISSVAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLIRLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFRRHFPVLFVSACLFILPVLLSYVLWHHYALNTWLFAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYYVRSTGSIIEFIFGVVMFGNGAYTMMFESGSKIRAFMMCLHAYFNIYLQAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD