You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CTLA4
Cytotoxic T-lymphocyte protein 4

Protein Summary
Description
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000295854
  • ENSP00000295854
  • ENSG00000163599
  • ENST00000302823
  • ENSP00000303939
  • ENST00000472206
  • ENSP00000417779
  • ENST00000487393
  • ENSP00000497319
  • ENST00000648405
  • ENSP00000497102

Symbol
  • CD152
  • CD
  • GSE
  • GRD4
  • ALPS5
  • CD152
  • CTLA-4
  • IDDM12
  • CELIAC3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease
0.88
phenotype
0.82
gene perturbation
0.76
biological term
0.73
biological process
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6375.76   (req: < 5)
Gene RIFs: 798   (req: <= 3)
Antibodies: 1282   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6375.76   (req: >= 5)
Gene RIFs: 798   (req: > 3)
Antibodies: 1282   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
ipilimumab
no chemical structure image available
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (48)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
CTLA4 inhibitory signaling
Reactome
Costimulation by the CD28 family
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
CTLA4 inhibitory signaling
Costimulation by the CD28 family
Gene expression (Transcription)
Generic Transcription Pathway
Gene Ontology Terms (16)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
MGI
Inferred from Mutant Phenotype (IMP)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (662)
1 – 10 of 662
IL13RA1
Tbio
Novelty: 0.03405858
p_int: 0.999994164
p_ni: 0.00000187
p_wrong: 0.000003966
Score: 0.186
Data Source: BioPlex,STRINGDB
RBFA
Tbio
Novelty: 0.12145749
p_int: 0.999994136
p_ni: 0.000005863
p_wrong: 1e-9
Data Source: BioPlex
CUEDC2
Tbio
Novelty: 0.07761966
p_int: 0.999990637
p_ni: 0.000009317
p_wrong: 4.5e-8
Data Source: BioPlex
UBB
Tbio
Novelty: 0.00895161
p_int: 0.999983327
p_ni: 0.000011709
p_wrong: 0.000004965
Data Source: BioPlex
ROBO1
Tbio
Novelty: 0.00585838
p_int: 0.999972804
p_ni: 0.000026066
p_wrong: 0.000001129
Data Source: BioPlex
LETMD1
Tbio
Novelty: 0.02546612
p_int: 0.999939899
p_ni: 0.000060101
Data Source: BioPlex
PLEKHB1
Tbio
Novelty: 0.01639226
p_int: 0.999935844
p_ni: 0.000006621
p_wrong: 0.000057535
Data Source: BioPlex
BLZF1
Tbio
Novelty: 0.07416445
p_int: 0.999935115
p_ni: 0.000064862
p_wrong: 2.3e-8
Data Source: BioPlex
DGAT1
Tclin
Family: Enzyme
Novelty: 0.0015819
p_int: 0.999928432
p_ni: 0.000071537
p_wrong: 3.1e-8
Data Source: BioPlex
KIT
Tclin
Family: Kinase
Novelty: 0.00013951
p_int: 0.999913862
p_ni: 1.3e-7
p_wrong: 0.000086008
Score: 0.56
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  6375.76

PubMed score by year
PubTator Score  2733.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVR
1-70
VTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYY
70-140
LGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPE
140-210
CEKQFQPYFIPIN
210-223
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN