Protein Classes
Protein Summary
Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells (PubMed:20068036). Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Oct 2014]
- ENST00000302247
- ENSP00000303532
- ENSG00000171711
- ENST00000318157
- ENSP00000424598
- ENSG00000177257
- ENST00000617136
- ENSP00000479138
- ENSG00000275444
- ENST00000642856
- ENSP00000496499
- ENSG00000285181
- ENST00000644124
- ENSP00000493760
- ENSG00000285433
- DEFB102
- DEFB2
- DEFB4
- DEFB4P
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
biological term | 0.99 | ||
cell type or tissue | 0.61 | ||
tissue | 0.57 | ||
disease | 0.56 | ||
phenotype | 0.5 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 98.72 (req: < 5)
Gene RIFs: 1 (req: <= 3)
Antibodies: 142 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 98.72 (req: >= 5)
Gene RIFs: 1 (req: > 3)
Antibodies: 142 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 12
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (8)
Reactome (5)
KEGG (3)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 5
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Antimicrobial peptides | ||||
Reactome | Beta defensins | ||||
Reactome | Defensins | ||||
Reactome | Immune System | ||||
Reactome | Innate Immune System | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Antimicrobial peptides | ||||
Beta defensins | ||||
Defensins | ||||
Immune System | ||||
Innate Immune System | ||||
Gene Ontology Terms (16)
Functions (2)
Components (4)
Processes (10)
Items per page:
10
1 – 2 of 2
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Protein-Protein Interactions (28)
1 – 10 of 28
ZMPSTE24
Family: Enzyme
Novelty: 0.00353005
p_int: 0.980841365
p_ni: 0.019158601
p_wrong: 3.4e-8
Data Source: BioPlex
SPAG11B
Novelty: 0.11942279
Score: 0.742
Data Source: STRINGDB
SPAG11A
Novelty: 0.29752066
Score: 0.742
Data Source: STRINGDB
DEFB1
Novelty: 0.0020205
Score: 0.679
Data Source: STRINGDB
DEFA3
Novelty: 0.0973624
Score: 0.626
Data Source: STRINGDB
DEFA4
Novelty: 0.09939219
Score: 0.625
Data Source: STRINGDB
S100A7
Novelty: 0.00508896
Score: 0.601
Data Source: STRINGDB
DEFA5
Novelty: 0.01045537
Score: 0.58
Data Source: STRINGDB
CAMP
Novelty: 0.00089449
Score: 0.58
Data Source: STRINGDB
DEFB104A
Novelty: 0.05631898
Score: 0.56
Data Source: STRINGDB
Publication Statistics
PubMed Score 98.72
PubMed score by year
PubTator Score 97.98
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
1-70
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Find similar targets by: