You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TACR3
Neuromedin-K receptor

Protein Summary
Description
This is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: neuromedin-K > substance K > substance P. This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neurokinin 3, also referred to as neurokinin B. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000304883
  • ENSP00000303325
  • ENSG00000169836

Symbol
  • NK3R
  • TAC3R
  • NK3
  • NKR
  • HH11
  • NK3R
  • NK-3R
  • TAC3R
  • TAC3RL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (chemical)
0.85
gene perturbation
0.74
cellular component
0.71
ligand (protein)
0.68
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 280.17   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 339   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 280.17   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 339   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 575
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
eledoisin
chemical structure image
Pathways (13)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Gene Ontology Terms (21)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (261)
1 – 10 of 261
C6orf47
Tdark
Novelty: 0.27025154
p_int: 0.999994504
p_ni: 0.000005493
p_wrong: 2e-9
Data Source: BioPlex
SNX27
Tbio
Novelty: 0.02796021
p_int: 0.999960081
p_ni: 0.000039919
Data Source: BioPlex
FARP2
Tbio
Novelty: 0.19204615
p_int: 0.999923549
p_ni: 0.000076409
p_wrong: 4.2e-8
Data Source: BioPlex
DMXL2
Tbio
Novelty: 0.09035497
p_int: 0.999896055
p_ni: 0.000103945
Data Source: BioPlex
RAP1A
Tchem
Family: Enzyme
Novelty: 0.00466391
p_int: 0.999643537
p_ni: 0.000336441
p_wrong: 0.000020022
Data Source: BioPlex
CERS5
Tbio
Family: TF
Novelty: 0.04558376
p_int: 0.999544167
p_ni: 0.000065122
p_wrong: 0.000390711
Data Source: BioPlex
PPFIBP1
Tbio
Novelty: 0.18266164
p_int: 0.999413557
p_ni: 0.000586443
Data Source: BioPlex
USP20
Tbio
Family: Enzyme
Novelty: 0.0779104
p_int: 0.999330858
p_ni: 0.000127423
p_wrong: 0.000541719
Data Source: BioPlex
REEP6
Tbio
Novelty: 0.17493781
p_int: 0.997865197
p_ni: 0.002133356
p_wrong: 0.000001448
Data Source: BioPlex
C2CD5
Tbio
Novelty: 0.79395085
p_int: 0.997309444
p_ni: 0.002689284
p_wrong: 0.000001272
Data Source: BioPlex
Publication Statistics
PubMed Score  280.17

PubMed score by year
PubTator Score  132.81

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQP
1-70
WANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTL
70-140
VNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWIL
140-210
AFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIP
210-280
GDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTM
280-350
YNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
350-420
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
420-465
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS