You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ACHE
Acetylcholinesterase

Protein Summary
Description
Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. Role in neuronal apoptosis. Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. Acetylcholinesterase exists in multiple molecular forms which possess similar catalytic properties, but differ in their oligomeric assembly and mode of cell attachment to the cell surface. It is encoded by the single ACHE gene, and the structural diversity in the gene products arises from alternative mRNA splicing, and post-translational associations of catalytic and structural subunits. The major form of acetylcholinesterase found in brain, muscle and other tissues is the hydrophilic species, which forms disulfide-linked oligomers with collagenous, or lipid-cont ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000241069
  • ENSP00000241069
  • ENSG00000087085
  • ENST00000302913
  • ENSP00000303211
  • ENST00000411582
  • ENSP00000404865
  • ENST00000412389
  • ENSP00000394976
  • ENST00000419336
  • ENSP00000403474
  • ENST00000428317
  • ENSP00000414858

Symbol
  • YT
  • ACEE
  • ARACHE
  • N-ACHE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
drug
1
biological process
0.91
molecular function
0.91
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2516.54   (req: < 5)
Gene RIFs: 138   (req: <= 3)
Antibodies: 714   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2516.54   (req: >= 5)
Gene RIFs: 138   (req: > 3)
Antibodies: 714   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 32
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1840
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 25
Active Ligands (1840)
1 – 10 of 1840
CHEMBL140476,CHEMBL536047
chemical structure image
CHEMBL1255901
chemical structure image
CHEMBL486698,CHEMBL292314
chemical structure image
CHEMBL433041
chemical structure image
CHEMBL32823,CHEMBL3752685
chemical structure image
CHEMBL231160
chemical structure image
CHEMBL208599
chemical structure image
CHEMBL28
chemical structure image
Protein Data Bank (24)
1 – 5 of 24
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (26)
Glycerophospholipid biosynthesis (R-HSA-1483206)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glycerophospholipid biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of proteins
Reactome
Neuronal System
Name
Explore in Pharos
Explore in Source
Glycerophospholipid biosynthesis
Metabolism
Metabolism of lipids
Metabolism of proteins
Neuronal System
Gene Ontology Terms (46)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
HGNC
Inferred from Physical Interaction (IPI)
HGNC
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (182)
1 – 10 of 182
CHAT
Tchem
Family: Enzyme
Novelty: 0.00038631
Score: 0.941
Data Source: STRINGDB
CHKA
Tchem
Family: Kinase
Novelty: 0.00334774
Score: 0.92
Data Source: STRINGDB
CHKB
Tbio
Family: Kinase
Novelty: 0.01524905
Score: 0.903
Data Source: STRINGDB
GPCPD1
Tdark
Family: Enzyme
Novelty: 0.01553765
Score: 0.902
Data Source: STRINGDB
PHOSPHO1
Tchem
Family: Enzyme
Novelty: 0.09057379
Score: 0.9
Data Source: STRINGDB
COLQ
Tbio
Family: Enzyme
Novelty: 0.01728852
Score: 0.886
Data Source: STRINGDB
APP
Tchem
Novelty: 0.00011446
Score: 0.834
Data Source: STRINGDB
CAT
Tbio
Family: Enzyme
Novelty: 0.00022628
Score: 0.817
Data Source: STRINGDB
PRIMA1
Tbio
Novelty: 0.00142786
Score: 0.797
Data Source: STRINGDB
CHRNE
Tclin
Family: IC
Novelty: 0.01820975
Score: 0.795
Data Source: STRINGDB
Publication Statistics
PubMed Score  2516.54

PubMed score by year
PubTator Score  9029.31

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAE
1-70
PPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPT
70-140
SPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLA
140-210
LQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRAT
210-280
QLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG
280-350
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
350-420
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL
420-490
DPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQAC
490-560
AFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL
560-614
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL