You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
PYGO1
Pygopus homolog 1

Protein Summary
Description
Involved in signal transduction through the Wnt pathway.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000302000
  • ENSP00000302327
  • ENSG00000171016
  • ENST00000563719
  • ENSP00000457777
  • ENST00000645724
  • ENSP00000496139
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.76
protein domain
0.73
cell type or tissue
0.55
biological process
0.54
histone modification site profile
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.3   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 153   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.3   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 153   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (78)
Deactivation of the beta-catenin transactivating complex (R-HSA-3769402)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Deactivation of the beta-catenin transactivating complex
Reactome
Formation of the beta-catenin:TCF transactivating complex
Reactome
Signal Transduction
Reactome
Signaling by WNT
Reactome
TCF dependent signaling in response to WNT
Name
Explore in Pharos
Explore in Source
Deactivation of the beta-catenin transactivating complex
Formation of the beta-catenin:TCF transactivating complex
Signal Transduction
Signaling by WNT
TCF dependent signaling in response to WNT
Gene Ontology Terms (11)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
FlyBase
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (64)
1 – 10 of 64
BCL9
Tbio
Novelty: 0.02276827
Score: 0.999
Data Source: Reactome,STRINGDB
HIST3H3
Tbio
Novelty: 0.09996887
Score: 0.994
Data Source: STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.957
Data Source: Reactome,STRINGDB
H3F3C
Tbio
Novelty: 0.07556919
Score: 0.957
Data Source: STRINGDB
H3F3A
Tbio
Novelty: 0.00644912
Score: 0.957
Data Source: STRINGDB
BCL9L
Tbio
Novelty: 0.08549112
Score: 0.956
Data Source: Reactome,STRINGDB
LEF1
Tchem
Family: TF
Novelty: 0.00223818
Score: 0.955
Data Source: Reactome,STRINGDB
HIST2H3A
Tbio
Novelty: 0.04593632
Score: 0.949
Data Source: STRINGDB
HIST1H3A
Tbio
Novelty: 0.01912636
Score: 0.947
Data Source: STRINGDB
HIST2H2AC
Tbio
Novelty: 0.00121358
Score: 0.935
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.30

PubMed score by year
PubTator Score  3.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPAENSPAPAYKVSSHGGDSGLDGLGGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAAN
1-70
PFDDNYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGF
70-140
NRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNS
140-210
NFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNN
210-280
AVNQENSRSSSTEATNNNPANGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGHSSSDPVYPCGICTNEV
280-350
NDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPSAVGSDA
350-419
MPAENSPAPAYKVSSHGGDSGLDGLGGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAANPFDDNYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNNAVNQENSRSSSTEATNNNPANGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPSAVGSDA