You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MGMT
Methylated-DNA--protein-cysteine methyltransferase

Protein Summary
Description
Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. [provided by RefSeq, Sep 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306010
  • ENSP00000302111
  • ENSG00000170430
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.98
chemical
0.89
histone modification site profile
0.87
disease
0.86
biological process
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1491.47   (req: < 5)
Gene RIFs: 541   (req: <= 3)
Antibodies: 758   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1491.47   (req: >= 5)
Gene RIFs: 541   (req: > 3)
Antibodies: 758   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 34
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
DNA Damage Reversal (R-HSA-73942)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA Damage Reversal
Reactome
DNA Repair
Reactome
MGMT-mediated DNA damage reversal
Name
Explore in Pharos
Explore in Source
DNA Damage Reversal
DNA Repair
MGMT-mediated DNA damage reversal
Gene Ontology Terms (20)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (183)
1 – 10 of 183
MLH1
Tbio
Novelty: 0.00040798
Score: 0.908
Data Source: STRINGDB
RASSF1
Tbio
Novelty: 0.00155893
Score: 0.899
Data Source: STRINGDB
IDH1
Tclin
Family: Enzyme
Novelty: 0.00047449
Score: 0.898
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.895
Data Source: STRINGDB
MSH6
Tbio
Family: Epigenetic
Novelty: 0.00148002
Score: 0.844
Data Source: STRINGDB
LIG4
Tbio
Family: Enzyme
Novelty: 0.00177803
Score: 0.84
Data Source: STRINGDB
TRIP12
Tbio
Family: Enzyme
Novelty: 0.00653395
Score: 0.831
Data Source: STRINGDB
OGG1
Tbio
Family: Enzyme
Novelty: 0.00054356
Score: 0.81
Data Source: STRINGDB
CDH13
Tbio
Novelty: 0.00447049
Score: 0.802
Data Source: STRINGDB
IDH2
Tclin
Family: Enzyme
Novelty: 0.00094359
Score: 0.8
Data Source: STRINGDB
Publication Statistics
PubMed Score  1491.47

PubMed score by year
PubTator Score  2260.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYF
1-70
HQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVP
70-140
ILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
140-207
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN