You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ECI1
Enoyl-CoA delta isomerase 1, mitochondrial

Protein Classes
Protein Summary
Description
Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species. This gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising during the stepwise degradation of cis-, mono-, and polyunsaturated fatty acids to the 2-trans-enoyl-CoA intermediates. Alternatively spliced transcript variants have been described. [provided by RefSeq, May 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000301729
  • ENSP00000301729
  • ENSG00000167969
  • ENST00000562238
  • ENSP00000456319

Symbol
  • DCI
  • DCI
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
kinase perturbation
0.93
disease
0.91
histone modification site profile
0.91
cellular component
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 504.59   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 266   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 504.59   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 266   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Fatty acid metabolism (R-HSA-8978868)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Mitochondrial Fatty Acid Beta-Oxidation
Reactome
mitochondrial fatty acid beta-oxidation of unsaturated fatty acids
Name
Explore in Pharos
Explore in Source
Fatty acid metabolism
Metabolism
Metabolism of lipids
Mitochondrial Fatty Acid Beta-Oxidation
mitochondrial fatty acid beta-oxidation of unsaturated fatty acids
Protein-Protein Interactions (71)
1 – 10 of 71
ECI2
Tbio
Family: Enzyme
Novelty: 0.03208207
Score: 0.993
Data Source: STRINGDB
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
Score: 0.959
Data Source: STRINGDB
EHHADH
Tbio
Novelty: 0.00763197
Score: 0.868
Data Source: STRINGDB
DECR1
Tbio
Family: Enzyme
Novelty: 0.01886929
Score: 0.825
Data Source: STRINGDB
HADHB
Tbio
Family: Enzyme
Novelty: 0.01003327
Score: 0.799
Data Source: STRINGDB
HADH
Tbio
Family: Enzyme
Novelty: 0.00360431
Score: 0.777
Data Source: STRINGDB
ACADS
Tbio
Family: Enzyme
Novelty: 0.00360385
Score: 0.74
Data Source: STRINGDB
PPP1R35
Tdark
Family: Enzyme
Novelty: 1.2
Score: 0.718
Data Source: STRINGDB
ACADVL
Tbio
Family: Enzyme
Novelty: 0.00501425
Score: 0.702
Data Source: STRINGDB
ACADM
Tbio
Family: Enzyme
Novelty: 0.00590747
Score: 0.692
Data Source: STRINGDB
Publication Statistics
PubMed Score  504.59

PubMed score by year
PubTator Score  21.3

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEPDAGAGVAVMKFKNPPVNSL
1-70
SLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRSPAHYAGYWKAVQELWLRLYQSNL
70-140
VLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGL
140-210
LFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSF
210-280
ISKDSIQKSLQMYLERLKEEKG
280-302
MALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRSPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQMYLERLKEEKG