You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
SOST
Sclerostin

Protein Summary
Description
Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000301691
  • ENSP00000301691
  • ENSG00000167941

Symbol
  • CDD
  • VBCH
  • DAND6
  • SOST1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.92
biological process
0.66
microRNA
0.62
transcription factor
0.62
phenotype
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1068.59   (req: < 5)
Gene RIFs: 230   (req: <= 3)
Antibodies: 505   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1068.59   (req: >= 5)
Gene RIFs: 230   (req: > 3)
Antibodies: 505   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
romosozumab
no chemical structure image available
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Negative regulation of TCF-dependent signaling by WNT ligand antagonists (R-HSA-3772470)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Negative regulation of TCF-dependent signaling by WNT ligand antagonists
Reactome
Signal Transduction
Reactome
Signaling by WNT
Reactome
TCF dependent signaling in response to WNT
Name
Explore in Pharos
Explore in Source
Negative regulation of TCF-dependent signaling by WNT ligand antagonists
Signal Transduction
Signaling by WNT
TCF dependent signaling in response to WNT
Gene Ontology Terms (15)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (135)
1 – 10 of 135
LRP6
Tbio
Novelty: 0.00325624
p_int: 0.999955988
p_ni: 0.000044012
Score: 0.991
Data Source: BioPlex,Reactome,STRINGDB
CSH2
Tbio
Novelty: 0.00107578
p_int: 0.999809456
p_ni: 0.000190544
Score: 0.187
Data Source: BioPlex,STRINGDB
LRP5
Tbio
Novelty: 0.00102638
p_int: 0.999754372
p_ni: 0.000245628
Score: 0.995
Data Source: BioPlex,STRINGDB
SPOP
Tbio
Novelty: 0.00958399
p_int: 0.999651631
p_ni: 0.000348365
p_wrong: 4e-9
Score: 0.177
Data Source: BioPlex,STRINGDB
SRRT
Tbio
Novelty: 0.00367694
p_int: 0.999561049
p_ni: 0.000438951
Data Source: BioPlex
SIRT1
Tchem
Family: Epigenetic
Novelty: 0.00025951
p_int: 0.993145885
p_ni: 0.006854115
Score: 0.285
Data Source: BioPlex,STRINGDB
GTF2I
Tbio
Family: TF
Novelty: 0.00870461
p_int: 0.991539435
p_ni: 0.008460565
Score: 0.195
Data Source: BioPlex,STRINGDB
PSMG2
Tbio
Novelty: 0.07196402
p_int: 0.987815457
p_ni: 0.012184541
p_wrong: 2e-9
Data Source: BioPlex
DCAF5
Tdark
Novelty: 1.07807487
p_int: 0.971741069
p_ni: 0.02825893
Data Source: BioPlex
HERC2
Tbio
Family: Enzyme
Novelty: 0.05519779
p_int: 0.971281535
p_ni: 0.028718465
Data Source: BioPlex
Publication Statistics
PubMed Score  1068.59

PubMed score by year
PubTator Score  418.32

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPF
1-70
ETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYR
70-140
AQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELE
140-210
NAY
210-213
MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY