You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CKB
Creatine kinase B-type

Protein Summary
Description
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000348956
  • ENSP00000299198
  • ENSG00000166165

Symbol
  • CKBB
  • BCK
  • B-CK
  • CKBB
  • CPK-B
  • HEL-211
  • HEL-S-29
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
interacting protein
0.97
PubMedID
0.97
transcription factor perturbation
0.96
molecular function
0.9


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 248.43   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 752   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 248.43   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 752   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Creatine metabolism (R-HSA-71288)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Creatine metabolism
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Name
Explore in Pharos
Explore in Source
Creatine metabolism
Metabolism
Metabolism of amino acids and derivatives
Gene Ontology Terms (14)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Sequence or structural Similarity (ISS)
AgBase
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (74)
1 – 10 of 74
CKM
Tbio
Family: Kinase
Novelty: 0.00329483
p_int: 0.999999949
p_ni: 5.1e-8
Score: 0.985
Data Source: BioPlex,Reactome,STRINGDB
ASB9
Tbio
Novelty: 0.18287144
p_int: 0.998523968
p_ni: 0.001476032
Score: 0.97
Data Source: BioPlex,STRINGDB
GAMT
Tbio
Family: Enzyme
Novelty: 0.00822106
Score: 0.956
Data Source: STRINGDB
MYH7B
Tbio
Novelty: 0.01329839
Score: 0.913
Data Source: STRINGDB
TPM3
Tbio
Novelty: 0.00170262
Score: 0.9
Data Source: STRINGDB
TPM4
Tbio
Novelty: 0.00688369
Score: 0.897
Data Source: STRINGDB
TPM1
Tbio
Novelty: 0.00363188
Score: 0.888
Data Source: STRINGDB
ACTN4
Tbio
Novelty: 0.00483615
Score: 0.88
Data Source: STRINGDB
ACTN1
Tbio
Novelty: 0.01041776
Score: 0.865
Data Source: STRINGDB
ACO2
Tbio
Family: Enzyme
Novelty: 0.00277235
Score: 0.863
Data Source: STRINGDB
Publication Statistics
PubMed Score  248.43

PubMed score by year
PubTator Score  510.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIM
1-70
TVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGF
70-140
CLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARD
140-210
WPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYI
210-280
LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELV
280-350
QMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
350-381
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK