You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PHOX2A
Paired mesoderm homeobox protein 2A

Protein Summary
Description
May be involved in regulating the specificity of expression of the catecholamine biosynthetic genes. Acts as a transcription activator/factor. Could maintain the noradrenergic phenotype. The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000298231
  • ENSP00000298231
  • ENSG00000165462

Symbol
  • ARIX
  • PMX2A
  • ARIX
  • FEOM2
  • NCAM2
  • PMX2A
  • CFEOM2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.78
cell type or tissue
0.77
biological process
0.66
cell line
0.61
PubMedID
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.77   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 195   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.77   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 195   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Sudden Infant Death Syndrome (SIDS) Susceptibility Pathways
WikiPathways
Sudden Infant Death Syndrome (SIDS) Susceptibility Pathways
WikiPathways
Serotonin and anxiety
WikiPathways
Fragile X Syndrome
Name
Explore in Pharos
Explore in Source
Sudden Infant Death Syndrome (SIDS) Susceptibility Pathways
Sudden Infant Death Syndrome (SIDS) Susceptibility Pathways
Serotonin and anxiety
Fragile X Syndrome
Protein-Protein Interactions (39)
1 – 10 of 39
ASCL1
Tbio
Family: TF
Novelty: 0.0034966
Score: 0.82
Data Source: STRINGDB
KIF21A
Tbio
Novelty: 0.01927563
Score: 0.807
Data Source: STRINGDB
DBH
Tchem
Family: Enzyme
Novelty: 0.00083795
Score: 0.751
Data Source: STRINGDB
HAND2
Tbio
Family: TF
Novelty: 0.00439742
Score: 0.742
Data Source: STRINGDB
ISL1
Tbio
Family: TF
Novelty: 0.00222272
Score: 0.714
Data Source: STRINGDB
NR2F6
Tbio
Family: NR
Novelty: 0.02380073
Score: 0.649
Data Source: STRINGDB
TUBB3
Tclin
Novelty: 0.00281462
Score: 0.647
Data Source: STRINGDB
TH
Tclin
Family: Enzyme
Novelty: 0.00030927
Score: 0.617
Data Source: STRINGDB
NANOG
Tbio
Family: TF
Novelty: 0.00073323
Score: 0.578
Data Source: STRINGDB
LMX1B
Tbio
Family: TF
Novelty: 0.00535467
Score: 0.577
Data Source: STRINGDB
Publication Statistics
PubMed Score  59.77

PubMed score by year
PubTator Score  54.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPY
1-70
SAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQN
70-140
RRAKFRKQERAASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPAPGLASPRLSPSPL
140-210
PVALGSGPGPGPGPQPLKGALWAGVAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALK
210-280
TNLF
280-284
MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPAPGLASPRLSPSPLPVALGSGPGPGPGPQPLKGALWAGVAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF