You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GPR101
Probable G-protein coupled receptor 101

Protein Summary
Description
Orphan receptor. The protein encoded by this gene is an orphan G protein-coupled receptor of unknown function. The encoded protein is a member of a family of proteins that contain seven transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000298110
  • ENSP00000298110
  • ENSG00000165370

Symbol
  • GPCR6
  • PAGH2
  • PITA2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.78
tissue
0.67
histone modification site profile
0.47
cell type or tissue
0.44
cell line
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.95   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 225   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.95   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 225   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (35)
1 – 10 of 35
AIP
Tbio
Novelty: 0.00986784
Score: 0.669
Data Source: STRINGDB
GPR27
Tdark
Family: GPCR
Novelty: 0.22950594
Score: 0.629
Data Source: STRINGDB
PRKAR1A
Tbio
Family: Enzyme
Novelty: 0.00372136
Score: 0.622
Data Source: STRINGDB
STMN1
Tbio
Novelty: 0.00103914
Score: 0.604
Data Source: STRINGDB
GPR62
Tbio
Family: GPCR
Novelty: 0.58385933
Score: 0.602
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.602
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.602
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.602
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.602
Data Source: STRINGDB
GPR162
Tbio
Family: GPCR
Novelty: 0.1214531
Score: 0.595
Data Source: STRINGDB
Publication Statistics
PubMed Score  25.95

PubMed score by year
PubTator Score  20.03

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MTSTCTNSTRESNSSHTCMPLSKMPISLAHGIIRSTVLVIFLAASFVGNIVLALVLQRKPQLLQVTNRFI
1-70
FNLLVTDLLQISLVAPWVVATSVPLFWPLNSHFCTALVSLTHLFAFASVNTIVVVSVDRYLSIIHPLSYP
70-140
SKMTQRRGYLLLYGTWIVAILQSTPPLYGWGQAAFDERNALCSMIWGASPSYTILSVVSFIVIPLIVMIA
140-210
CYSVVFCAARRQHALLYNVKRHSLEVRVKDCVENEDEEGAEKKEEFQDESEFRRQHEGEVKAKEGRMEAK
210-280
DGSLKAKEGSTGTSESSVEARGSEEVRESSTVASDGSMEGKEGSTKVEENSMKADKGRTEVNQCSIDLGE
280-350
DDMEFGEDDINFSEDDVEAVNIPESLPPSRRNSNSNPPLPRCYQCKAAKVIFIIIFSYVLSLGPYCFLAV
350-420
LAVWVDVETQVPQWVITIIIWLFFLQCCIHPYVYGYMHKTIKKEIQDMLKKFFCKEKPPKEDSHPDLPGT
420-490
EGGTEGKIVPSYDSATFP
490-508
MTSTCTNSTRESNSSHTCMPLSKMPISLAHGIIRSTVLVIFLAASFVGNIVLALVLQRKPQLLQVTNRFIFNLLVTDLLQISLVAPWVVATSVPLFWPLNSHFCTALVSLTHLFAFASVNTIVVVSVDRYLSIIHPLSYPSKMTQRRGYLLLYGTWIVAILQSTPPLYGWGQAAFDERNALCSMIWGASPSYTILSVVSFIVIPLIVMIACYSVVFCAARRQHALLYNVKRHSLEVRVKDCVENEDEEGAEKKEEFQDESEFRRQHEGEVKAKEGRMEAKDGSLKAKEGSTGTSESSVEARGSEEVRESSTVASDGSMEGKEGSTKVEENSMKADKGRTEVNQCSIDLGEDDMEFGEDDINFSEDDVEAVNIPESLPPSRRNSNSNPPLPRCYQCKAAKVIFIIIFSYVLSLGPYCFLAVLAVWVDVETQVPQWVITIIIWLFFLQCCIHPYVYGYMHKTIKKEIQDMLKKFFCKEKPPKEDSHPDLPGTEGGTEGKIVPSYDSATFP