You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZMAT4
Zinc finger matrin-type protein 4

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297737
  • ENSP00000297737
  • ENSG00000165061
  • ENST00000315769
  • ENSP00000319785
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.61
phenotype
0.58
protein domain
0.58
PubMedID
0.58
disease
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.82   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 138   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.82   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 138   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (58)
1 – 10 of 58
CALHM4
Tdark
Family: IC
p_int: 0.999610557
p_ni: 0.000389247
p_wrong: 1.97e-7
Score: 0.169
Data Source: BioPlex,STRINGDB
DSG4
Tbio
Novelty: 0.00431663
p_int: 0.997798309
p_ni: 0.002201691
Data Source: BioPlex
HEPHL1
Tbio
Novelty: 0.46750499
p_int: 0.995252797
p_ni: 0.004747203
Data Source: BioPlex
LYG2
Tbio
Family: Enzyme
Novelty: 0.15083867
p_int: 0.99522772
p_ni: 0.00477228
Data Source: BioPlex
S100A3
Tbio
Novelty: 0.0418135
p_int: 0.992951769
p_ni: 0.000406677
p_wrong: 0.006641553
Data Source: BioPlex
VSIG8
Tdark
Novelty: 1.45341615
p_int: 0.983683211
p_ni: 0.016316777
p_wrong: 1.2e-8
Data Source: BioPlex
NEU2
Tbio
Family: Enzyme
Novelty: 0.00721856
p_int: 0.961218216
p_ni: 0.038768945
p_wrong: 0.000012839
Score: 0.181
Data Source: BioPlex,STRINGDB
TRIM29
Tbio
Novelty: 0.03164477
p_int: 0.780205087
p_ni: 0.219794904
p_wrong: 9e-9
Score: 0.173
Data Source: BioPlex,STRINGDB
LRRC15
Tbio
Novelty: 0.00183551
p_int: 0.780195825
p_ni: 0.219804175
Score: 0.271
Data Source: BioPlex,STRINGDB
PRKRA
Tbio
Family: Kinase
Novelty: 0.02773053
Score: 0.794
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.82

PubMed score by year
PubTator Score  2.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADM
1-70
VDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPLSPLKPPRMDTAPVVASPYQR
70-140
RDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSI
140-210
EQYHAHLKGSKHQTNLKNK
210-229
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPLSPLKPPRMDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYHAHLKGSKHQTNLKNK