You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
UBAP1
Ubiquitin-associated protein 1

Protein Summary
Description
Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Plays a role in the proteasomal degradation of ubiquitinated cell-surface proteins, such as EGFR and BST2. This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297661
  • ENSP00000297661
  • ENSG00000165006
  • ENST00000359544
  • ENSP00000352541
  • ENST00000379186
  • ENSP00000368484
  • ENST00000625521
  • ENSP00000486574

Symbol
  • UAP
  • UBAP
  • NAG20
  • UBAP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.89
kinase perturbation
0.84
disease perturbation
0.74
transcription factor binding site profile
0.74
virus perturbation
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 172.59   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 180   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 172.59   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 180   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Assembly Of The HIV Virion (R-HSA-175474)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Assembly Of The HIV Virion
Reactome
Autophagy
Reactome
Budding and maturation of HIV virion
Reactome
Disease
Reactome
Endosomal Sorting Complex Required For Transport (ESCRT)
Name
Explore in Pharos
Explore in Source
Assembly Of The HIV Virion
Autophagy
Budding and maturation of HIV virion
Disease
Endosomal Sorting Complex Required For Transport (ESCRT)
Gene Ontology Terms (11)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (84)
1 – 10 of 84
VPS28
Tbio
Novelty: 0.04542177
p_int: 1
Score: 0.994
Data Source: BioPlex,Reactome,STRINGDB
VPS37A
Tbio
Novelty: 0.12564317
p_int: 0.999999979
p_ni: 2e-9
p_wrong: 1.9e-8
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
VPS37B
Tbio
Novelty: 0.39431873
p_int: 0.999999439
p_ni: 5.61e-7
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
TSG101
Tbio
Novelty: 0.00310287
p_int: 0.999798431
p_ni: 0.000201569
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
MVB12A
Tbio
Novelty: 0.01270321
Score: 0.978
Data Source: STRINGDB
MVB12B
Tbio
Novelty: 0.07628042
Score: 0.974
Data Source: STRINGDB
VPS37C
Tbio
Novelty: 0.36129032
Score: 0.965
Data Source: Reactome,STRINGDB
VPS37D
Tdark
Novelty: 3.21428571
Score: 0.965
Data Source: Reactome,STRINGDB
VPS36
Tbio
Novelty: 0.04226354
Score: 0.963
Data Source: Reactome,STRINGDB
PTPN23
Tbio
Family: Enzyme
Novelty: 0.03305773
Score: 0.962
Data Source: STRINGDB
Publication Statistics
PubMed Score  172.59

PubMed score by year
PubTator Score  17.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIK
1-70
KIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSAT
70-140
KQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQ
140-210
DEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKT
210-280
AKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCT
280-350
EESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI
350-420
EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDN
420-490
ALEDLMARAGAS
490-502
MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQDEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCTEESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAGAS