You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TNFRSF11B
Tumor necrosis factor receptor superfamily member 11B

Protein Summary
Description
Acts as decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between TNFSF11 and TNFRSF11B. May also play a role in preventing arterial calcification. May act as decoy receptor for TNFSF10/TRAIL and protect against apoptosis. TNFSF10/TRAIL binding blocks the inhibition of osteoclastogenesis. The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297350
  • ENSP00000297350
  • ENSG00000164761

Symbol
  • OCIF
  • OPG
  • OPG
  • TR1
  • OCIF
  • PDB5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
gene perturbation
0.98
disease
0.85
kinase perturbation
0.84
cell type or tissue
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1703.4   (req: < 5)
Gene RIFs: 608   (req: <= 3)
Antibodies: 715   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1703.4   (req: >= 5)
Gene RIFs: 608   (req: > 3)
Antibodies: 715   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNFR2 non-canonical NF-kB pathway
Reactome
TNFs bind their physiological receptors
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Gene Ontology Terms (18)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (118)
1 – 10 of 118
TNFSF11
Tclin
Novelty: 0.00023862
Score: 0.999
Data Source: Reactome,STRINGDB
TNFSF10
Tbio
Novelty: 0.00125816
Score: 0.968
Data Source: STRINGDB
BGLAP
Tbio
Novelty: 0.00011426
Score: 0.892
Data Source: STRINGDB
ACP5
Tbio
Family: Enzyme
Novelty: 0.0004216
Score: 0.86
Data Source: STRINGDB
PTH
Tbio
Novelty: 0.00003793
Score: 0.813
Data Source: STRINGDB
RUNX2
Tbio
Family: TF
Novelty: 0.00035641
Score: 0.8
Data Source: STRINGDB
SOST
Tclin
Novelty: 0.00097341
Score: 0.792
Data Source: STRINGDB
CTSK
Tchem
Family: Enzyme
Novelty: 0.00091225
Score: 0.774
Data Source: STRINGDB
SPP1
Tbio
Novelty: 0.00020502
Score: 0.762
Data Source: STRINGDB
IL1B
Tclin
Novelty: 0.00003644
Score: 0.736
Data Source: STRINGDB
Publication Statistics
PubMed Score  1703.40

PubMed score by year
PubTator Score  2288.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYY
1-70
TDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNT
70-140
VCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFA
140-210
VPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENS
210-280
VQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALK
280-350
HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
350-401
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL