You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GFM2
Ribosome-releasing factor 2, mitochondrial

Protein Classes
Protein Summary
Description
Mitochondrial GTPase that mediates the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis. Acts in collaboration with MRRF. GTP hydrolysis follows the ribosome disassembly and probably occurs on the ribosome large subunit. Not involved in the GTP-dependent ribosomal translocation step during translation elongation. Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors, which is a GTPase that plays a role at the termination of mitochondrial translation by mediating the disassembly of ribosomes from messenger RNA . Its role in the regulation of normal mitochondrial function and in disease ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296805
  • ENSP00000296805
  • ENSG00000164347
  • ENST00000345239
  • ENSP00000296804
  • ENST00000427854
  • ENSP00000405808
  • ENST00000509430
  • ENSP00000427004

Symbol
  • EFG2
  • EFG2
  • RRF2
  • MRRF2
  • hEFG2
  • MST027
  • RRF2mt
  • EF-G2mt
  • MSTP027
  • mEF-G 2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
molecular function
0.96
transcription factor perturbation
0.91
transcription factor binding site profile
0.83
histone modification site profile
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.25   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 125   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.25   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 125   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Mitochondrial translation
Reactome
Mitochondrial translation termination
Reactome
Translation
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Mitochondrial translation
Mitochondrial translation termination
Translation
Gene Ontology Terms (7)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Protein-Protein Interactions (192)
1 – 10 of 192
PSG8
Tdark
Novelty: 0.31837916
p_int: 0.999887262
p_ni: 0.000112736
p_wrong: 2e-9
Data Source: BioPlex
YBEY
Tdark
Family: Enzyme
Novelty: 0.05001786
p_int: 0.999434314
p_ni: 0.000483257
p_wrong: 0.000082429
Data Source: BioPlex
GLB1L3
Tdark
Family: Enzyme
Novelty: 1.68674699
p_int: 0.998787891
p_ni: 0.001209264
p_wrong: 0.000002845
Data Source: BioPlex
NDUFS7
Tclin
Family: Enzyme
Novelty: 0.00101318
p_int: 0.998019896
p_ni: 0.001962729
p_wrong: 0.000017375
Score: 0.25
Data Source: BioPlex,STRINGDB
BPNT1
Tbio
Family: Enzyme
Novelty: 0.13729977
p_int: 0.997144565
p_ni: 0.002849821
p_wrong: 0.000005615
Score: 0.266
Data Source: BioPlex,STRINGDB
MRPL12
Tbio
Novelty: 0.16043959
p_int: 0.996236307
p_ni: 0.003749174
p_wrong: 0.000014519
Score: 0.972
Data Source: BioPlex,STRINGDB
TUFM
Tbio
Novelty: 0.04189381
p_int: 0.99578213
p_ni: 0.004210935
p_wrong: 0.000006936
Score: 0.566
Data Source: BioPlex,STRINGDB
RARS2
Tbio
Family: Enzyme
Novelty: 0.01344299
p_int: 0.991584967
p_ni: 0.002053795
p_wrong: 0.006361238
Score: 0.475
Data Source: BioPlex,STRINGDB
MRPS17
Tdark
Novelty: 1.18644068
p_int: 0.929367693
p_ni: 0.061539143
p_wrong: 0.009093164
Data Source: BioPlex
TLE1
Tbio
Novelty: 0.00854022
p_int: 0.908583782
p_ni: 0.091416218
Data Source: BioPlex
Publication Statistics
PubMed Score  38.25

PubMed score by year
PubTator Score  12.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSLHSIINPPIAKI
1-70
RNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYRVNLI
70-140
DTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRICFLNKMDKTGASFKYAVES
140-210
IREKLKAKPLLLQLPIGEAKTFKGVVDVVMKEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNAL
210-280
IEQVADLDDEFADLVLEEFSENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLP
280-350
SPEERNYEFLQWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQ
350-420
HVEIPSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEIPEPVF
420-490
FCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPL
490-560
QVAYRETILNSVRATDTLDRTLGDKRHLVTVEVEARPIETSSVMPVIEFEYAESINEGLLKVSQEAIENG
560-630
IHSACLQGPLLGSPIQDVAITLHSLTIHPGTSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDY
630-700
LSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNT
700-770
LLNRRSGLT
770-779
MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSLHSIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRICFLNKMDKTGASFKYAVESIREKLKAKPLLLQLPIGEAKTFKGVVDVVMKEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNALIEQVADLDDEFADLVLEEFSENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLPSPEERNYEFLQWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQHVEIPSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEIPEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDKRHLVTVEVEARPIETSSVMPVIEFEYAESINEGLLKVSQEAIENGIHSACLQGPLLGSPIQDVAITLHSLTIHPGTSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNTLLNRRSGLT